SERCA2 ATPase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
SERCA2 ATPase
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
ATP2BFLJ20293, ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform, cardiac Ca2+ ATPase, DAR, DD, EC 3.6.3, EC 3.6.3.8, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, FLJ38063, MGC45367, sarcoplasmic/endoplasmic reticulum calcium ATPase 2, SERCA2DKFZp686P0211, SR Ca(2+)-ATPase 2
Gene Symbols
ATP2A2
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
488
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AWWFIAADGGPRVSFYQLSHFLQCKEDNPDFE
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- Description SERCA2 ATPase Polyclonal specifically detects SERCA2 ATPase in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SERCA2 ATPase
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: ATP2BFLJ20293, ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform, cardiac Ca2+ ATPase, DAR, DD, EC 3.6.3, EC 3.6.3.8, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, FLJ38063, MGC45367, sarcoplasmic/endoplasmic reticulum calcium ATPase 2, SERCA2DKFZp686P0211, SR Ca(2+)-ATPase 2
Gene Symbols: ATP2A2
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 488
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AWWFIAADGGPRVSFYQLSHFLQCKEDNPDFE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: ERG28
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: chromosome 14 open reading frame 1, ERG28, NET51, probable ergosterol biosynthetic protein 28
Gene Symbols: C14ORF1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 11161
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MLVGLRYLEVEPVSRQKKRN
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: GMPR2
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: EC 1.7.1.7, GMP reductase 2, Guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase 2MGC830, guanosine monophosphate reductase isolog, MGC15084
Gene Symbols: GMPR2
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 51292
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTSCLPALRFIATPRLSAMPHIDNDVKLDFKD
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.