Soluble Liver/Pancreas Antigen Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Soluble Liver/Pancreas Antigen
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
EC 2.9.1.2, EC 2.9.1.n1, Liver-pancreas antigen, LPDKFZp434B1417, MGC161491, O-phosphoseryl-tRNA(Sec) selenium transferase, Sec synthase, Selenocysteine synthase, Selenocysteinyl-tRNA(Sec) synthase, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase, SepSecS, Sep-tRNA:Sec-tRNA synthase, SLA/LP, SLA/LP autoantigen, SLA-p35, SLAUGA suppressor tRNA-associated protein, Soluble liver antigen, soluble liver antigen/liver pancreas antigen, tRNA(Ser/Sec)-associated antigenic protein, TRNP48
Gene Symbols
SEPSECS
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
51091
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- Soluble Liver/Pancreas Antigen Polyclonal specifically detects Soluble Liver/Pancreas Antigen in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Soluble Liver/Pancreas Antigen
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: EC 2.9.1.2, EC 2.9.1.n1, Liver-pancreas antigen, LPDKFZp434B1417, MGC161491, O-phosphoseryl-tRNA(Sec) selenium transferase, Sec synthase, Selenocysteine synthase, Selenocysteinyl-tRNA(Sec) synthase, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase, SepSecS, Sep-tRNA:Sec-tRNA synthase, SLA/LP, SLA/LP autoantigen, SLA-p35, SLAUGA suppressor tRNA-associated protein, Soluble liver antigen, soluble liver antigen/liver pancreas antigen, tRNA(Ser/Sec)-associated antigenic protein, TRNP48
Gene Symbols: SEPSECS
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 51091
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: SCF/c-kit Ligand
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, KIT ligand, Kitl, KL-1, Mast cell growth factor, MGFSHEP7, SCFStem cell factor, SFc-Kit ligand, steel factor
Gene Symbols: KITLG
Isotype: IgG
Purification Method: Affinity Purified
Applications: __
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 4254
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YWKKRQPSLTRAVENIQINEEDNEISMLQEK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Plexin A3
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: HSSEXGENE, plexin A3, Plexin-4, plexin-A3, PLXN3, PLXN4, Semaphorin receptor SEX, Sex chromosome X transmembrane protein of HGF receptor family 3, SEXPLEXIN-A3,6.3, XAP-6
Gene Symbols: PLXNA3
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 55558
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
