4-1BB/TNFRSF9/CD137 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
4-1BB/TNFRSF9/CD137
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Stem Cells
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
3604
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
4-1BB, 4-1BB ligand receptor, CD137 antigen, CD137MGC2172, CDw137, FLJ43501, ILAhomolog of mouse 4-1BB, induced by lymphocyte activation (ILA), interleukin-activated receptor, homolog of mouse Ly63, receptor protein 4-1BB, T cell antigen ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, tumor necrosis factor receptor superfamily member 9, tumor necrosis factor receptor superfamily, member 9
Gene Symbols
TNFRSF9
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- 4-1BB/TNFRSF9/CD137 Polyclonal specifically detects 4-1BB/TNFRSF9/CD137 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: 4-1BB/TNFRSF9/CD137
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Stem Cells
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 3604
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: 4-1BB, 4-1BB ligand receptor, CD137 antigen, CD137MGC2172, CDw137, FLJ43501, ILAhomolog of mouse 4-1BB, induced by lymphocyte activation (ILA), interleukin-activated receptor, homolog of mouse Ly63, receptor protein 4-1BB, T cell antigen ILA, T-cell antigen 4-1BB homolog, T-cell antigen ILA, tumor necrosis factor receptor superfamily member 9, tumor necrosis factor receptor superfamily, member 9
Gene Symbols: TNFRSF9
Isotype: IgG
Purification Method: Affinity Purified
Antigen: FAM18B2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 201158
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: family with sequence similarity 18, member B2, hypothetical protein LOC201158, MGC8763
Gene Symbols: TVP23C
Isotype: IgG
Purification Method: Affinity Purified
Antigen: ZNF432
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9668
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSLCLFRENHDT
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: ZNF432 zinc finger protein 432
Gene Symbols: ZNF432
Isotype: IgG
Purification Method: Affinity Purified
