Lysine (K)-specific Demethylase 3A/KDM3A/JMJD1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Lysine (K)-specific Demethylase 3A/KDM3A/JMJD1A
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Chromatin Modifiers, Epigenetics
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
55818
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KECLPTKASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACRSQNLKESSVKVDNESCCSRSNNKIQNAPSRKSVL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
EC 1.14.11, EC 1.14.11.-, JHDM2AJMJD1AJHMD2A, JmjC domain-containing histone demethylation protein 2A, JMJD1, jumonji C domain-containing histone demethylase 2A, jumonji domain containing 1, jumonji domain containing 1A, Jumonji domain-containing protein 1A, KIAA0742DKFZp686A24246, lysine (K)-specific demethylase 3A, lysine-specific demethylase 3A, testis-specific protein A, TSGADKFZp686P07111
Gene Symbols
KDM3A
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- Lysine (K)-specific Demethylase 3A/KDM3A/JMJD1A Polyclonal specifically detects Lysine (K)-specific Demethylase 3A/KDM3A/JMJD1A in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Lysine (K)-specific Demethylase 3A/KDM3A/JMJD1A
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Chromatin Modifiers, Epigenetics
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 55818
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KECLPTKASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACRSQNLKESSVKVDNESCCSRSNNKIQNAPSRKSVL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: EC 1.14.11, EC 1.14.11.-, JHDM2AJMJD1AJHMD2A, JmjC domain-containing histone demethylation protein 2A, JMJD1, jumonji C domain-containing histone demethylase 2A, jumonji domain containing 1, jumonji domain containing 1A, Jumonji domain-containing protein 1A, KIAA0742DKFZp686A24246, lysine (K)-specific demethylase 3A, lysine-specific demethylase 3A, testis-specific protein A, TSGADKFZp686P07111
Gene Symbols: KDM3A
Isotype: IgG
Purification Method: Affinity Purified
Antigen: TNRC6C
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 57690
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GGLSVKDPSQSQSRLPQWTHPNSMDNLPSAASPLEQNPSKHGAIPGGLSIGPPGKSSIDDSYGRYDLIQNSESPASPPVAVPHSWSRAKSDSDKISNGSSINWPPEFHPGV
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: KIAA1582FLJ20015, trinucleotide repeat containing 6C, trinucleotide repeat-containing gene 6C protein
Gene Symbols: TNRC6C
Isotype: IgG
Purification Method: Affinity Purified
Antigen: TNRC6C
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 57690
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GGLSVKDPSQSQSRLPQWTHPNSMDNLPSAASPLEQNPSKHGAIPGGLSIGPPGKSSIDDSYGRYDLIQNSESPASPPVAVPHSWSRAKSDSDKISNGSSINWPPEFHPGV
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: KIAA1582FLJ20015, trinucleotide repeat containing 6C, trinucleotide repeat-containing gene 6C protein
Gene Symbols: TNRC6C
Isotype: IgG
Purification Method: Affinity Purified
