CD39L2/ENTPD6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
CD39L2/ENTPD6
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Lipid and Metabolism
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
955
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution
Immunohistochemistry-Paraffin 1:500 - 1:1000
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
CD39 antigen-like 2, CD39L2NTPDase-6, CD39-like 2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, EC 3.6.1.6, ectonucleoside triphosphate diphosphohydrolase 6, ectonucleoside triphosphate diphosphohydrolase 6 (putative function), ectonucleoside triphosphate diphosphohydrolase 6 (putative), FLJ36711, IL-6SAG, IL6ST2, interleukin 6 signal transducer-2, NTPDase 6
Gene Symbols
ENTPD6
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- CD39L2/ENTPD6 Polyclonal specifically detects CD39L2/ENTPD6 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CD39L2/ENTPD6
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Lipid and Metabolism
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 955
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: CD39 antigen-like 2, CD39L2NTPDase-6, CD39-like 2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, EC 3.6.1.6, ectonucleoside triphosphate diphosphohydrolase 6, ectonucleoside triphosphate diphosphohydrolase 6 (putative function), ectonucleoside triphosphate diphosphohydrolase 6 (putative), FLJ36711, IL-6SAG, IL6ST2, interleukin 6 signal transducer-2, NTPDase 6
Gene Symbols: ENTPD6
Isotype: IgG
Purification Method: Affinity Purified
Antigen: Lipin 3
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 64900
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: __
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: dJ450M14.2, dJ450M14.3, dJ620E11.2, EC 3.1.3.4, lipin 3, lipin 3-like, lipin-3, Lipin-3-like, LIPN3L, phosphatidate phosphatase LPIN3, SMP2
Gene Symbols: LPIN3
Isotype: IgG
Purification Method: Affinity Purified
Antigen: TMEM133
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 83935
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PLLQNVPVPLGNNVGKMQVYE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: __
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: AD031, MGC138255, transmembrane protein 133
Gene Symbols: TMEM133
Isotype: IgG
Purification Method: Affinity Purified