PSMB5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
PSMB5
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
5693
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
LMPXproteasome beta 5 subunit, Macropain epsilon chain, MB1EC 3.4.25.1, Multicatalytic endopeptidase complex epsilon chain, proteasome (prosome, macropain) subunit, beta type, 5, proteasome catalytic subunit 3, Proteasome chain 6, Proteasome epsilon chain, proteasome subunit beta type-5, Proteasome subunit MB1, Proteasome subunit X, proteasome subunit, beta type, 5, PSX large multifunctional protease X, XMGC104214
Gene Symbols
PSMB5
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- PSMB5 Polyclonal specifically detects PSMB5 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PSMB5
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 5693
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: LMPXproteasome beta 5 subunit, Macropain epsilon chain, MB1EC 3.4.25.1, Multicatalytic endopeptidase complex epsilon chain, proteasome (prosome, macropain) subunit, beta type, 5, proteasome catalytic subunit 3, Proteasome chain 6, Proteasome epsilon chain, proteasome subunit beta type-5, Proteasome subunit MB1, Proteasome subunit X, proteasome subunit, beta type, 5, PSX large multifunctional protease X, XMGC104214
Gene Symbols: PSMB5
Isotype: IgG
Purification Method: Affinity Purified
Antigen: RNF160
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 26046
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ECLRFIMQQNLGEEEIEQMLVNDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADTEKDEKTAHNLENVLI
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: __
Gene Symbols: LTN1
Isotype: IgG
Purification Method: Affinity Purified
Antigen: RNF160
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 26046
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ECLRFIMQQNLGEEEIEQMLVNDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADTEKDEKTAHNLENVLI
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: __
Gene Symbols: LTN1
Isotype: IgG
Purification Method: Affinity Purified
