PIP5K2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
PIP5K2B
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cancer
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
8396
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta, Diphosphoinositide kinase 2-beta, EC 2.7.1, EC 2.7.1.149, phosphatidylinositol-4-phosphate 5-kinase, type II, beta, Phosphatidylinositol-5-phosphate 4-kinase type II beta, phosphatidylinositol-5-phosphate 4-kinase type-2 beta, phosphatidylinositol-5-phosphate 4-kinase, type II, beta, PI(5)P 4-kinase type II beta, PI5P4KB, PIP4KII-beta, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PTDINS(4)P-5-kinase, PtdIns(5)P-4-kinase isoform 2-beta
Gene Symbols
PIP4K2B
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- PIP5K2B Polyclonal specifically detects PIP5K2B in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PIP5K2B
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cancer
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 8396
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: 1-phosphatidylinositol-4-phosphate kinase, 1-phosphatidylinositol-5-phosphate 4-kinase 2-beta, Diphosphoinositide kinase 2-beta, EC 2.7.1, EC 2.7.1.149, phosphatidylinositol-4-phosphate 5-kinase, type II, beta, Phosphatidylinositol-5-phosphate 4-kinase type II beta, phosphatidylinositol-5-phosphate 4-kinase type-2 beta, phosphatidylinositol-5-phosphate 4-kinase, type II, beta, PI(5)P 4-kinase type II beta, PI5P4KB, PIP4KII-beta, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PTDINS(4)P-5-kinase, PtdIns(5)P-4-kinase isoform 2-beta
Gene Symbols: PIP4K2B
Isotype: IgG
Purification Method: Affinity Purified
Antigen: GRHL3
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 57822
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: grainyhead-like 3 (Drosophila), MGC46624, Sister of mammalian grainyhead, sister-of-mammalian grainyhead, SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog, TFCP2L4, transcription factor hSOM1
Gene Symbols: GRHL3
Isotype: IgG
Purification Method: Affinity Purified
Antigen: __
Classification: __
Host Species: __
Research Discipline: __
Formulation: __
Gene ID (Entrez): __
Immunogen: __
Primary or Secondary: __
Test Specificity: __
Applications: __
Conjugate: __
Regulatory Status: __
Target Species: __
Gene Alias: __
Gene Symbols: __
Isotype: __
Purification Method: __
