DYRK1 Rabbit anti-Human, Mouse, Non-human Primate, Rat, Polyclonal, FabGennix
Manufacturer: Fabgennix Inc
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | 50-220-6802-Each-of-1 | In Stock | ₹ 32,261.25 |
50-220-6802 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 32,261.25
GST (18%): ₹ 5,807.025
Total Price: ₹ 38,068.275
Antigen
DYRK1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
DYRK1A
Gene Alias
2310043O08Rik; D16Ertd272e; D16Ertd493e; dual specificity tyrosine phosphorylation regulated kinase 1A; dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A; dual specificity tyrosine-phosphorylation-regulated kinase 1A; Dual specificity YAK1-related kinase; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a; Dyrk; DYRK1; Dyrk1a; ENSMUSG00000074897; Gm10783; hMNB; HP86; mmb; MNB; mnb protein kinase homolog hp86; MNB/DYRK protein kinase; MNBH; MP86; MRD7; OTTHUMP00000109090; Protein kinase minibrain homolog; PSK47; RP86; serine/threonine kinase MNB; serine/threonine-specific protein kinase
Immunogen
Synthetic peptide taken within amino acid region 300-350 on human Dual specificity tyrosine-phosphorylation-regulated kinase 1A.
Quantity
200 μL
Primary or Secondary
Primary
Target Species
Human, Mouse, Non-human Primate, Rat
Product Type
Antibody
Isotype
IgG
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Concentration
0.5-1.5 mg/mL
Formulation
proprietary buffer with 0.5% BSA, 30% glycerol and 0.02% sodium azide; pH 7.4-7.8
Gene Accession No.
Q13627, Q61214, Q63470
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
13548, 1859, 25255, 458545
Content And Storage
-20°C
Form
Liquid
Description
- DYRK1 Polyclonal antibody specifically detects DYRK1 in Human, Mouse, Non-human Primate, Rat samples
- It is validated for ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Compare Similar Items
Show Difference
Antigen: DYRK1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: DYRK1A
Gene Alias: 2310043O08Rik; D16Ertd272e; D16Ertd493e; dual specificity tyrosine phosphorylation regulated kinase 1A; dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A; dual specificity tyrosine-phosphorylation-regulated kinase 1A; Dual specificity YAK1-related kinase; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a; Dyrk; DYRK1; Dyrk1a; ENSMUSG00000074897; Gm10783; hMNB; HP86; mmb; MNB; mnb protein kinase homolog hp86; MNB/DYRK protein kinase; MNBH; MP86; MRD7; OTTHUMP00000109090; Protein kinase minibrain homolog; PSK47; RP86; serine/threonine kinase MNB; serine/threonine-specific protein kinase
Immunogen: Synthetic peptide taken within amino acid region 300-350 on human Dual specificity tyrosine-phosphorylation-regulated kinase 1A.
Quantity: 200 μL
Primary or Secondary: Primary
Target Species: Human, Mouse, Non-human Primate, Rat
Product Type: Antibody
Isotype: IgG
Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Concentration: 0.5-1.5 mg/mL
Formulation: proprietary buffer with 0.5% BSA, 30% glycerol and 0.02% sodium azide; pH 7.4-7.8
Gene Accession No.: Q13627, Q61214, Q63470
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 13548, 1859, 25255, 458545
Content And Storage: -20°C
Form: Liquid
Antigen: DYRK2
Classification: Polyclonal
Conjugate: Unconjugated
Gene: DYRK2
Gene Alias: 1810038L18Rik; dual specificity tyrosine phosphorylation regulated kinase 2; dual specificity tyrosine-(Y)-phosphorylation regulated kinase 2; dual specificity tyrosine-phosphorylation-regulated kinase 2; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2; dyrk2
Immunogen: Synthetic peptide taken within amino acid region 550-601 on human Dual specificity tyrosine-phosphorylation-regulated kinase 2.
Quantity: 200 μL
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Concentration: 0.5-1.5 mg/mL
Formulation: proprietary buffer with 0.5% BSA, 30% glycerol and 0.02% sodium azide; pH 7.4-7.8
Gene Accession No.: Q5U4C9, Q92630
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 314862, 69181, 8445
Content And Storage: -20°C
Form: Liquid
Antigen: E2F1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: E2F1
Gene Alias: E2F transcription factor 1; E2F1; E2F-1; mKIAA4009; PBR3; PRB-binding protein E2F-1; RBAP1; RBAP-1; RBBP3; RBBP-3; RBP3; Retinoblastoma-associated protein 1; retinoblastoma-binding protein 3; Transcription factor E2F1
Immunogen: Synthetic peptide corresponding to amino acids 58-93 of Human E2F1.Sequence:PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Quantity: 200 μL
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Applications: ELISA, Immunoprecipitation, Western Blot
Concentration: 0.5-1.5 mg/mL
Formulation: proprietary buffer with 0.5% BSA, 30% glycerol and 0.02% sodium azide; pH 7.4-7.8
Gene Accession No.: O09139, Q01094, Q61501
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 13555, 1869, 399489
Content And Storage: -20°C
Form: Liquid
