GluA1/GluR1 Monoclonal Antibody (S355-1), QED Bioscience™
Manufacturer: Qed Bioscience Inc
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | 50-227-8232-Each-of-1 | In Stock | ₹ 47,451.58 |
50-227-8232 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 47,451.58
GST (18%): ₹ 8,541.284
Total Price: ₹ 55,992.864
Antigen
GluA1/GluR1
Classification
Monoclonal
Concentration
0.5-1.0 mg/mL
Formulation
PBS with 50% glycerol and 0.09% sodium azide; pH 7.4
Gene Accession No.
P19490, P23818
Host Species
Mouse
Purification Method
Protein A
Regulatory Status
RUO
Gene ID (Entrez)
14799, 50592
Content And Storage
-20° C, Avoid Freeze/Thaw Cycles
Form
Liquid
Applications
Immunocytochemistry, Western Blot
Clone
S355-1
Conjugate
Unconjugated
Gene
GRIA1
Gene Alias
2900051M01Rik; AI853806; AMPA 1; AMPA glutamate receptor; AMPA receptor GluR1/A; AMPA-selective glutamate receptor 1; Glr1; Glr-1; GluA1; GLUH 1; GLUH1; GluR K1; GLUR1; Glur-1; GluR1 flip; GluR1 flop; GLURA; GluR-A; GluRK1; gluR-K1; glutamate ionotropic receptor AMPA type subunit 1; glutamate receptor; glutamate receptor 1; glutamate receptor A; glutamate receptor ionotropic, AMPA 1; glutamate receptor subunit GluR1; glutamate receptor, ionotropic, AMPA 1; glutamate receptor, ionotropic, AMPA1 (alpha 1); GPRC1A; Gria 1; Gria1; GRM1A; HBGR1; HGBR1; HIPA; HIPA1; MGC13325; MGC133252; mGlu1; MGLUR1; MGLUR1A; NMDA1; NMDAR1; NR1; OTTHUMP00000160643; OTTHUMP00000165781; OTTHUMP00000224241; OTTHUMP00000224242; OTTHUMP00000224243; RP11-350O14.1
Immunogen
Fusion protein corresponding to aa 1-389 (extracellular N-terminus) of rat GluA1/GluR1 (accession no. P19490).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Mouse, Rat
Product Type
Antibody
Isotype
IgG1
Related Products
Description
- Description GluA1/GluR1 Monoclonal antibody specifically detects GluA1/GluR1 in Mouse, Rat samples
- It is validated for Immunocytochemistry, Western Blot
Compare Similar Items
Show Difference
Antigen: GluA1/GluR1
Classification: Monoclonal
Concentration: 0.5-1.0 mg/mL
Formulation: PBS with 50% glycerol and 0.09% sodium azide; pH 7.4
Gene Accession No.: P19490, P23818
Host Species: Mouse
Purification Method: Protein A
Regulatory Status: RUO
Gene ID (Entrez): 14799, 50592
Content And Storage: -20° C, Avoid Freeze/Thaw Cycles
Form: Liquid
Applications: Immunocytochemistry, Western Blot
Clone: S355-1
Conjugate: Unconjugated
Gene: GRIA1
Gene Alias: 2900051M01Rik; AI853806; AMPA 1; AMPA glutamate receptor; AMPA receptor GluR1/A; AMPA-selective glutamate receptor 1; Glr1; Glr-1; GluA1; GLUH 1; GLUH1; GluR K1; GLUR1; Glur-1; GluR1 flip; GluR1 flop; GLURA; GluR-A; GluRK1; gluR-K1; glutamate ionotropic receptor AMPA type subunit 1; glutamate receptor; glutamate receptor 1; glutamate receptor A; glutamate receptor ionotropic, AMPA 1; glutamate receptor subunit GluR1; glutamate receptor, ionotropic, AMPA 1; glutamate receptor, ionotropic, AMPA1 (alpha 1); GPRC1A; Gria 1; Gria1; GRM1A; HBGR1; HGBR1; HIPA; HIPA1; MGC13325; MGC133252; mGlu1; MGLUR1; MGLUR1A; NMDA1; NMDAR1; NR1; OTTHUMP00000160643; OTTHUMP00000165781; OTTHUMP00000224241; OTTHUMP00000224242; OTTHUMP00000224243; RP11-350O14.1
Immunogen: Fusion protein corresponding to aa 1-389 (extracellular N-terminus) of rat GluA1/GluR1 (accession no. P19490).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse, Rat
Product Type: Antibody
Isotype: IgG1
Antigen: Ataxin-1
Classification: Monoclonal
Concentration: 1 mg/mL
Formulation: PBS with 50% glycerol and 0.1% sodium azide; pH 7.4
Gene Accession No.: P54253, P54254, Q63540
Host Species: Mouse
Purification Method: Protein A
Regulatory Status: RUO
Gene ID (Entrez): 20238, 25049, 6310
Content And Storage: -20° C, Avoid Freeze/Thaw Cycles
Form: Liquid
Applications: Immunocytochemistry, Western Blot
Clone: S65-37
Conjugate: Unconjugated
Gene: ATXN1
Gene Alias: 2900016G23Rik; alternative ataxin1; ataxin 1; Ataxin1; ataxin-1; Atx1; Atx-1; Atx-1-PB; Atxn1; C85907; CG4547; CG4547-PB; D6S504E; dAtx-1; Dmel\CG4547; Dmel_CG4547; ENSMUSG00000074917; Gm10786; OTTHUMP00000016065; SCA1; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog
Immunogen: Synthetic peptide corresponding to aa 746-761 (RKRRRWSAPETRKLEK) of mouse ataxin-1. This sequence is 93
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG1
Antigen: Ataxin-1
Classification: Monoclonal
Concentration: 1 mg/mL
Formulation: PBS with 50% glycerol and 0.1% sodium azide; pH 7.4
Gene Accession No.: P54253, P54254, Q63540
Host Species: Mouse
Purification Method: Protein A
Regulatory Status: RUO
Gene ID (Entrez): 20238, 25049, 6310
Content And Storage: -20° C, Avoid Freeze/Thaw Cycles
Form: Liquid
Applications: Immunocytochemistry, Western Blot
Clone: S76-8
Conjugate: Unconjugated
Gene: ATXN1
Gene Alias: 2900016G23Rik; alternative ataxin1; ataxin 1; Ataxin1; ataxin-1; Atx1; Atx-1; Atx-1-PB; Atxn1; C85907; CG4547; CG4547-PB; D6S504E; dAtx-1; Dmel\CG4547; Dmel_CG4547; ENSMUSG00000074917; Gm10786; OTTHUMP00000016065; SCA1; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog
Immunogen: Synthetic peptide corresponding to aa 164-197 (ATTPSQRSQLEAYSTLLAN-MGSLSQAPGHKVEPP) of mouse Ataxin-1.
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG2b
