Neuropeptide Y Antibody, Novus Biologicals™
Goat Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Neuropeptide Y
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Immunohistochemistry (Free Floating)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human, Mouse, Rat, Rabbit, Xenopus species, Zebrafish
Gene Accession No.
P57774
Gene ID (Entrez)
4852
Immunogen
A synthetic peptide from amino acid region 20-70 of mouse Neuropeptide Y conjugated to an immunogenic carrier protein was used as the immunogen. The antigen is homologous in many other species including human, rat, zebrafish and Xenopus species.
Primary or Secondary
Primary
Reconstitution
Reconstitute in 150 ul of sterile water. Centrifuge to remove any insoluble material. Glycerol may be added (1:1) for additional stability. Please note the sample size is provided in reconstituted format.
Test Specificity
Specific for NPY.
Dilution
Western Blot 1:300-1:3000, Immunohistochemistry 1:300-1:3000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:300-1:3000, Immunohistochemistry-Frozen 1:300-1:3000, Immunohistochemistry Free-Floating
Classification
Polyclonal
Host Species
Goat
Research Discipline
GPCR, Neuroscience, Neurotransmission
Formulation
Lyophilized from whole antisera with No Preservative
Gene Alias
170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, seprase
Gene Symbols
NPY
Isotype
IgG
Purification Method
Unpurified
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Neuropeptide Y Polyclonal antibody specifically detects Neuropeptide Y in Human, Mouse, Rat, Rabbit, Xenopus species samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Immunohistochemistry - Free Floating.
Compare Similar Items
Show Difference
Antigen: Neuropeptide Y
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Immunohistochemistry (Free Floating)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human, Mouse, Rat, Rabbit, Xenopus species, Zebrafish
Gene Accession No.: P57774
Gene ID (Entrez): 4852
Immunogen: A synthetic peptide from amino acid region 20-70 of mouse Neuropeptide Y conjugated to an immunogenic carrier protein was used as the immunogen. The antigen is homologous in many other species including human, rat, zebrafish and Xenopus species.
Primary or Secondary: Primary
Reconstitution: Reconstitute in 150 ul of sterile water. Centrifuge to remove any insoluble material. Glycerol may be added (1:1) for additional stability. Please note the sample size is provided in reconstituted format.
Test Specificity: Specific for NPY.
Dilution: Western Blot 1:300-1:3000, Immunohistochemistry 1:300-1:3000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:300-1:3000, Immunohistochemistry-Frozen 1:300-1:3000, Immunohistochemistry Free-Floating
Classification: Polyclonal
Host Species: Goat
Research Discipline: GPCR, Neuroscience, Neurotransmission
Formulation: Lyophilized from whole antisera with No Preservative
Gene Alias: 170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, seprase
Gene Symbols: NPY
Isotype: IgG
Purification Method: Unpurified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: CAMP/Cathelicidin
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: P49913
Gene ID (Entrez): 820
Immunogen: A synthetic peptide from human CAMP/Cathelicidin conjugated to an immunogenic carrier protein has been used as the antigen.
Primary or Secondary: Primary
Reconstitution: Reconstitute in 0.1 ml of sterile water. Centrifuge to remove any insoluble material. Glycerol may be added (1:1) for additional stability. Please note the sample size is provided in reconstituted format.
Test Specificity: Specific for Cathelicidin antimicrobial peptide.
Dilution: Western Blot 5-10 ug/ml, Flow Cytometry 5-10 ug/ml, Immunohistochemistry 5-10 ug/ml, Immunocytochemistry/Immunofluorescence 5-10 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 5-10 ug/ml
Classification: Monoclonal
Host Species: Mouse
Research Discipline: __
Formulation: __
Gene Alias: 18 kDa cationic antimicrobial protein, Antibacterial peptide FALL-39, CAP18, CAP-18, cathelicidin antimicrobial peptide, CRAMP, epididymis secretory sperm binding protein, FALL39, FALL-39, FALL-39 peptide antibiotic, hCAP-181, HSD26, LL37
Gene Symbols: CAMP
Isotype: IgG1 κ
Purification Method: Ammonium sulfate precipitation
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: ROR alpha/NR1F1
Applications: __
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: __
Gene Accession No.: P35398
Gene ID (Entrez): 6095
Immunogen: Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC.
Primary or Secondary: Primary
Reconstitution: __
Test Specificity: __
Dilution: __
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: GPCR
Formulation: __
Gene Alias: DKFZp686M2414, MGC119326, NR1F1MGC119329, nuclear receptor ROR-alpha, Nuclear receptor RZR-alpha, Nuclear receptor subfamily 1 group F member 1, RAR-related orphan receptor A, RAR-related orphan receptor alpha, retinoic acid receptor-related orphan receptor alpha, retinoid-related orphan receptor alpha, Retinoid-related orphan receptor-alpha, ROR1, ROR2, ROR3, RZR-ALPHA, RZRAROR-alpha, transcription factor RZR-alpha
Gene Symbols: RORA
Isotype: IgG
Purification Method: Protein A purified
Content And Storage: __
