POLR2K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
POLR2K
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
DNA Repair, DNA replication Transcription Translation and Splicing
Gene Alias
ABC10-alpha, DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide, DNA-directed RNA polymerase II subunit K, DNA-directed RNA polymerases I, II, and III subunit RPABC4, hRPB7.0, hsRPB10a, polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa, RNA polymerase II 7.0 kDa subunit, RNA polymerases I, II, and III subunit ABC4, RPABC4, RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD), RPB12, RPB7.0
Gene Symbols
POLR2K
Isotype
IgG
Test Specificity
This product is specific to Subunit or Isoform: RPABC4.
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Accession No.
P53803
Gene ID (Entrez)
5440
Immunogen
Synthetic peptides corresponding to POLR2K(polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa) The peptide sequence was selected from the middle region of POLR2K (NP_005025). Peptide sequence DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR.
Primary or Secondary
Primary
Molecular Weight of Antigen
7 kDa
Description
- POLR2K Polyclonal specifically detects POLR2K in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: POLR2K
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
Gene Alias: ABC10-alpha, DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide, DNA-directed RNA polymerase II subunit K, DNA-directed RNA polymerases I, II, and III subunit RPABC4, hRPB7.0, hsRPB10a, polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa, RNA polymerase II 7.0 kDa subunit, RNA polymerases I, II, and III subunit ABC4, RPABC4, RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD), RPB12, RPB7.0
Gene Symbols: POLR2K
Isotype: IgG
Test Specificity: This product is specific to Subunit or Isoform: RPABC4.
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: P53803
Gene ID (Entrez): 5440
Immunogen: Synthetic peptides corresponding to POLR2K(polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa) The peptide sequence was selected from the middle region of POLR2K (NP_005025). Peptide sequence DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR.
Primary or Secondary: Primary
Molecular Weight of Antigen: 7 kDa
Antigen: GMPPB
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: EC 2.7.7.13, GDP-mannose pyrophosphorylase BKIAA1851, GTP-mannose-1-phosphate guanylyltransferase beta, mannose-1-phosphate guanyltransferase beta, mannose-1-phosphate guanylyltransferase
Gene Symbols: GMPPB
Isotype: IgG
Test Specificity: __
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q9Y5P6-2
Gene ID (Entrez): 29925
Immunogen: Synthetic peptides corresponding to GMPPB(GDP-mannose pyrophosphorylase B) The peptide sequence was selected from the C terminal of GMPPB. Peptide sequence RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM.
Primary or Secondary: Primary
Molecular Weight of Antigen: 43 kDa
Antigen: CDYL2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: CDY-like 2, chromodomain protein, Y-like 2, chromodomain Y-like protein 2, FLJ38866
Gene Symbols: CDYL2
Isotype: IgG
Test Specificity: __
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q8N8U2
Gene ID (Entrez): 124359
Immunogen: Synthetic peptides corresponding to CDYL2(chromodomain protein, Y-like 2) The peptide sequence was selected from the N terminal of CDYL2 (NP_689555). Peptide sequence NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG.
Primary or Secondary: Primary
Molecular Weight of Antigen: 57 kDa
