PIST Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
PIST
Classification
Polyclonal
Host Species
Rabbit
Gene Alias
CALPDZ protein interacting specifically with TC10, CFTR-associated ligand, dJ94G16.2, FIGdJ94G16.2 PIST, Fused in glioblastoma, golgi-associated PDZ and coiled-coil motif containing, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC1, PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10, PISTGolgi associated PDZ and coiled-coil motif containing protein
Gene Symbols
GOPC
Isotype
IgG
Molecular Weight of Antigen
50 kDa
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene ID (Entrez)
57120
Immunogen
Synthetic peptides corresponding to GOPC(golgi associated PDZ and coiled-coil motif containing) The peptide sequence was selected from the N terminal of GOPC. Peptide sequence EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA.
Primary or Secondary
Primary
Description
- PIST Polyclonal specifically detects PIST in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: PIST
Classification: Polyclonal
Host Species: Rabbit
Gene Alias: CALPDZ protein interacting specifically with TC10, CFTR-associated ligand, dJ94G16.2, FIGdJ94G16.2 PIST, Fused in glioblastoma, golgi-associated PDZ and coiled-coil motif containing, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC1, PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10, PISTGolgi associated PDZ and coiled-coil motif containing protein
Gene Symbols: GOPC
Isotype: IgG
Molecular Weight of Antigen: 50 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene ID (Entrez): 57120
Immunogen: Synthetic peptides corresponding to GOPC(golgi associated PDZ and coiled-coil motif containing) The peptide sequence was selected from the N terminal of GOPC. Peptide sequence EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA.
Primary or Secondary: Primary
Antigen: FAIM1
Classification: Polyclonal
Host Species: Rabbit
Gene Alias: FAIM1FLJ10582, Fas apoptotic inhibitory molecule, fas apoptotic inhibitory molecule 1
Gene Symbols: FAIM
Isotype: IgG
Molecular Weight of Antigen: 24 kDa
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene ID (Entrez): 55179
Immunogen: Synthetic peptides corresponding to FAIM(Fas apoptotic inhibitory molecule) The peptide sequence was selected from the N terminal of FAIM. Peptide sequence MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG.
Primary or Secondary: Primary
Antigen: METTL2B
Classification: Polyclonal
Host Species: Rabbit
Gene Alias: EC 2.1.1, EC 2.1.1.-, FLJ11350, FLJ12760, methyltransferase like 2, methyltransferase like 2B, methyltransferase-like protein 2B, METL, METTL2, METTL2A, PSENIP1
Gene Symbols: METTL2B
Isotype: IgG
Molecular Weight of Antigen: 43 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene ID (Entrez): 55798
Immunogen: Synthetic peptides corresponding to METTL2B(methyltransferase like 2B) The peptide sequence was selected from the N terminal of METTL2B. Peptide sequence INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS.
Primary or Secondary: Primary
