PRMT8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
PRMT8
Classification
Polyclonal
Form
Purified
Regulatory Status
RUO
Gene Alias
EC 2.1.1, EC 2.1.1.-, EC 2.1.1.77, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4, HMT1 hnRNP methyltransferase-like 3, HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae), HMT1 hnRNP methyltransferase-like 4, HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae), HRMT1L3, HRMT1L4, protein arginine methyltransferase 8, protein arginine N-methyltransferase 4, protein arginine N-methyltransferase 8
Gene Symbols
PRMT8
Isotype
IgG
Purification Method
Protein A purified
Applications
Western Blot
Conjugate
Unconjugated
Host Species
Rabbit
Gene Accession No.
Q9NR22
Gene ID (Entrez)
56341
Immunogen
Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND.
Primary or Secondary
Primary
Molecular Weight of Antigen
43 kDa
Description
- PRMT8 Polyclonal specifically detects PRMT8 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: PRMT8
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Gene Alias: EC 2.1.1, EC 2.1.1.-, EC 2.1.1.77, Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4, HMT1 hnRNP methyltransferase-like 3, HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae), HMT1 hnRNP methyltransferase-like 4, HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae), HRMT1L3, HRMT1L4, protein arginine methyltransferase 8, protein arginine N-methyltransferase 4, protein arginine N-methyltransferase 8
Gene Symbols: PRMT8
Isotype: IgG
Purification Method: Protein A purified
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Gene Accession No.: Q9NR22
Gene ID (Entrez): 56341
Immunogen: Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND.
Primary or Secondary: Primary
Molecular Weight of Antigen: 43 kDa
Antigen: FBXO22
Classification: Polyclonal
Form: __
Regulatory Status: RUO
Gene Alias: F-box only protein 22, F-box protein 22, F-box protein FBX22p44, FBX22FLJ13986, FIST domain containing 1, FISTC1, MGC31799
Gene Symbols: FBXO22
Isotype: IgG
Purification Method: __
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Gene Accession No.: Q8NEZ5
Gene ID (Entrez): 26263
Immunogen: Synthetic peptides corresponding to FBXO22(F-box protein 22) The peptide sequence was selected from the middle region of FBXO22. Peptide sequence CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE.
Primary or Secondary: Primary
Molecular Weight of Antigen: 30 kDa
Antigen: EXOC6
Classification: Polyclonal
Form: __
Regulatory Status: RUO
Gene Alias: DKFZp761I2124, EXOC6A, exocyst complex component 6, Exocyst complex component Sec15A, FLJ1125, FLJ11251, MGC33397, SEC15A, SEC15L1SEC15-like 1 (S. cerevisiae), SEC15L3, SEC15-like 1, SEC15-like protein 1, SEC15-like protein 3, SEC15LSEC15, Sec15p
Gene Symbols: EXOC6
Isotype: IgG
Purification Method: __
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Gene Accession No.: B3KXY5
Gene ID (Entrez): 54536
Immunogen: Synthetic peptides corresponding to EXOC6(exocyst complex component 6) Antibody(against the N terminal of EXOC6. Peptide sequence MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI.
Primary or Secondary: Primary
Molecular Weight of Antigen: 88 kDa
