17 beta-HSD1/HSD17B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
17 beta-HSD1/HSD17B1
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Breast Cancer, Cancer
Gene Alias
17-beta-HSD 1, 17-beta-hydroxysteroid dehydrogenase type 1, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, E17KSR, E2DH, EC 1.1.1.62, EDH17B1, EDH17B2EDHB17, estradiol 17-beta-dehydrogenase 1, estradiol 17-beta-dehydrogenase-1, HSD17, hydroxysteroid (17-beta) dehydrogenase 1, hydroxysteroid (17-beta) dehydrogenase 1 isoform, MGC138140, Placental 17-beta-hydroxysteroid dehydrogenase, SDR28C1, short chain dehydrogenase/reductase family 28CE, member 1
Gene Symbols
HSD17B1
Isotype
IgG
Molecular Weight of Antigen
35 kDa
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Accession No.
P14061
Gene ID (Entrez)
3292
Immunogen
Synthetic peptides corresponding to HSD17B1(hydroxysteroid (17-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of HSD17B1 (NP_000404). Peptide sequence MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA.
Primary or Secondary
Primary
Related Products
Description
- 17 beta-HSD1/HSD17B1 Polyclonal specifically detects 17 beta-HSD1/HSD17B1 in Human, Mouse samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: 17 beta-HSD1/HSD17B1
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Breast Cancer, Cancer
Gene Alias: 17-beta-HSD 1, 17-beta-hydroxysteroid dehydrogenase type 1, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, E17KSR, E2DH, EC 1.1.1.62, EDH17B1, EDH17B2EDHB17, estradiol 17-beta-dehydrogenase 1, estradiol 17-beta-dehydrogenase-1, HSD17, hydroxysteroid (17-beta) dehydrogenase 1, hydroxysteroid (17-beta) dehydrogenase 1 isoform, MGC138140, Placental 17-beta-hydroxysteroid dehydrogenase, SDR28C1, short chain dehydrogenase/reductase family 28CE, member 1
Gene Symbols: HSD17B1
Isotype: IgG
Molecular Weight of Antigen: 35 kDa
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: P14061
Gene ID (Entrez): 3292
Immunogen: Synthetic peptides corresponding to HSD17B1(hydroxysteroid (17-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of HSD17B1 (NP_000404). Peptide sequence MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA.
Primary or Secondary: Primary
Antigen: PAFAH1B2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: EC 3.1.1.47, intracellular platelet-activating factor acetylhydrolase alpha 2 subunit, PAF acetylhydrolase 30 kDa subunit, PAF-AH 30 kDa subunit, PAFAH subunit beta, PAF-AH subunit beta, PAF-AH1b alpha 2 subunit, PAFAHB, platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa), platelet-activating factor acetylhydrolase IB subunit beta, platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa)
Gene Symbols: PAFAH1B2
Isotype: IgG
Molecular Weight of Antigen: __
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: O35264
Gene ID (Entrez): 5049
Immunogen: __
Primary or Secondary: Primary
Antigen: KHDRBS2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: hSLM-1, KH domain containing, RNA binding, signal transduction associated 2, KH domain-containing, RNA-binding, signal transduction-associated protein 2, MGC26664, Sam68-like mammalian protein 1, SLM1bA535F17.1, SLM-1FLJ38664
Gene Symbols: KHDRBS2
Isotype: IgG
Molecular Weight of Antigen: __
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q5VWX1
Gene ID (Entrez): 202559
Immunogen: __
Primary or Secondary: Primary
