Proteasome 20S beta 6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Proteasome 20S beta 6
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene Alias
DELTA, EC 3.4.25.1, LMPY, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, proteasome (prosome, macropain) subunit, beta type, 6, proteasome catalytic subunit 1, Proteasome delta chain, proteasome subunit beta 6, proteasome subunit beta type-6, proteasome subunit delta, Proteasome subunit Y, PSY large multifunctional protease Y, YMGC5169
Gene Symbols
PSMB6
Isotype
IgG
Test Specificity
This product is specific to Subunit or Isoform: beta type-6.
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Accession No.
P28072
Gene ID (Entrez)
5694
Immunogen
Synthetic peptides corresponding to PSMB6(proteasome (prosome, macropain) subunit, beta type, 6) The peptide sequence was selected from the N terminal of PSMB6. Peptide sequence TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA.
Primary or Secondary
Primary
Description
- Proteasome 20S beta 6 Polyclonal specifically detects Proteasome 20S beta 6 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: Proteasome 20S beta 6
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene Alias: DELTA, EC 3.4.25.1, LMPY, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, proteasome (prosome, macropain) subunit, beta type, 6, proteasome catalytic subunit 1, Proteasome delta chain, proteasome subunit beta 6, proteasome subunit beta type-6, proteasome subunit delta, Proteasome subunit Y, PSY large multifunctional protease Y, YMGC5169
Gene Symbols: PSMB6
Isotype: IgG
Test Specificity: This product is specific to Subunit or Isoform: beta type-6.
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: P28072
Gene ID (Entrez): 5694
Immunogen: Synthetic peptides corresponding to PSMB6(proteasome (prosome, macropain) subunit, beta type, 6) The peptide sequence was selected from the N terminal of PSMB6. Peptide sequence TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA.
Primary or Secondary: Primary
Antigen: AFAP
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: actin filament associated protein 1, FLJ56849
Gene Symbols: AFAP1
Isotype: IgG
Test Specificity: __
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q8N556
Gene ID (Entrez): 60312
Immunogen: Synthetic peptides corresponding to AFAP1(actin filament associated protein 1) The peptide sequence was selected from the middle region of AFAP1. Peptide sequence QVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPT.
Primary or Secondary: Primary
Antigen: SENP3
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: DKFZP586K0919, DKFZp762A152, EC 3.4.22, EC 3.4.22.-, sentrin/SUMO-specific protease 3, Sentrin/SUMO-specific protease SENP3, sentrin-specific protease 3, SMT3IP1, SSP3DKFZp586K0919, SUMO1/sentrin/SMT3 specific peptidase 3, SUMO1/sentrin/SMT3 specific protease 3, SUMO-1-specific protease 3, SUSP3
Gene Symbols: SENP3
Isotype: IgG
Test Specificity: __
Applications: __
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: __
Gene ID (Entrez): 26168
Immunogen: Synthetic peptides corresponding to SENP3(SUMO1/sentrin/SMT3 specific peptidase 3) The peptide sequence was selected from the N terminal of SENP3. Peptide sequence PPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEE.
Primary or Secondary: Primary
