BRUNOL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
BRUNOL4
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
Q9BZC1
Gene ID (Entrez)
56853
Immunogen
Synthetic peptides corresponding to BRUNOL4(bruno-like 4, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL4 (NP_064565). Peptide sequence PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI.
Primary or Secondary
Primary
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
Bruno (Drosophila) -like 4, RNA binding protein, BRUNOL-4, BRUNOL4Bruno -like 4, RNA binding protein, bruno-like 4, RNA binding protein, bruno-like 4, RNA binding protein (Drosophila), Bruno-like protein 4, CELF-4, CUG-BP and ETR-3 like factor 4, CUG-BP- and ETR-3-like factor 4, CUGBP Elav-like family member 4, CUGBP, Elav-like family member 4, LYST-interacting protein LIP9, RNA-binding protein BRUNOL4, RNA-binding protein BRUNOL-4
Gene Symbols
CELF4
Isotype
IgG
Molecular Weight of Antigen
52 kDa
Description
- BRUNOL4 Polyclonal specifically detects BRUNOL4 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: BRUNOL4
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q9BZC1
Gene ID (Entrez): 56853
Immunogen: Synthetic peptides corresponding to BRUNOL4(bruno-like 4, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL4 (NP_064565). Peptide sequence PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Bruno (Drosophila) -like 4, RNA binding protein, BRUNOL-4, BRUNOL4Bruno -like 4, RNA binding protein, bruno-like 4, RNA binding protein, bruno-like 4, RNA binding protein (Drosophila), Bruno-like protein 4, CELF-4, CUG-BP and ETR-3 like factor 4, CUG-BP- and ETR-3-like factor 4, CUGBP Elav-like family member 4, CUGBP, Elav-like family member 4, LYST-interacting protein LIP9, RNA-binding protein BRUNOL4, RNA-binding protein BRUNOL-4
Gene Symbols: CELF4
Isotype: IgG
Molecular Weight of Antigen: 52 kDa
Antigen: PCBP3
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: P57721
Gene ID (Entrez): 54039
Immunogen: Synthetic peptides corresponding to PCBP3(poly(rC) binding protein 3) The peptide sequence was selected from the middle region of PCBP3. Peptide sequence QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Alpha-CP3, poly (rC)-binding protein 310ALPHA-CP3, poly(rC) binding protein 3, poly(rC)-binding protein 3
Gene Symbols: PCBP3
Isotype: IgG
Molecular Weight of Antigen: __
Antigen: DDX42
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q86XP3
Gene ID (Entrez): 11325
Immunogen: Synthetic peptides corresponding to DDX42 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 42) The peptide sequence was selected from the N terminal of DDX42 (NP_031398). Peptide sequence PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: DEAD (Asp-Glu-Ala-Asp) box polypeptide 42, DEAD box protein 42, EC 3.6.1, EC 3.6.4.13, RHELPSF3b DEAD box protein, RNA helicase-like protein, RNA helicase-related protein, RNAHPFLJ43179, SF3b125 DEAD-box protein, SF3b125ATP-dependent RNA helicase DDX42, Splicing factor 3B-associated 125 kDa protein
Gene Symbols: DDX42
Isotype: IgG
Molecular Weight of Antigen: __
