FOX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
FOX2
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cell Cycle and Replication
Gene ID (Entrez)
23543
Immunogen
Synthetic peptides corresponding to RBM9(RNA binding motif protein 9) The peptide sequence was selected from the middle region of RBM9. Peptide sequence TAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAP.
Primary or Secondary
Primary
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
dJ106I20.3, Fox-1 homolog B, fox-1 homologue, FOX2Fox-2, fxh, hexaribonucleotide binding protein 2, Hexaribonucleotide-binding protein 2, HRNBP2FOX-2, RBM9RTAHNRBP2, Repressor of tamoxifen transcriptional activity, RNA binding motif protein 9, RNA binding protein fox-1 homolog 2, RNA binding protein, fox-1 homolog (C. elegans) 2, RNA-binding motif protein 9, RNA-binding protein 9
Gene Symbols
RBFOX2
Isotype
IgG
Related Products
Description
- FOX2 Polyclonal specifically detects FOX2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: FOX2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 23543
Immunogen: Synthetic peptides corresponding to RBM9(RNA binding motif protein 9) The peptide sequence was selected from the middle region of RBM9. Peptide sequence TAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAP.
Primary or Secondary: Primary
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: dJ106I20.3, Fox-1 homolog B, fox-1 homologue, FOX2Fox-2, fxh, hexaribonucleotide binding protein 2, Hexaribonucleotide-binding protein 2, HRNBP2FOX-2, RBM9RTAHNRBP2, Repressor of tamoxifen transcriptional activity, RNA binding motif protein 9, RNA binding protein fox-1 homolog 2, RNA binding protein, fox-1 homolog (C. elegans) 2, RNA-binding motif protein 9, RNA-binding protein 9
Gene Symbols: RBFOX2
Isotype: IgG
Antigen: RNMT
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene ID (Entrez): 8731
Immunogen: Synthetic peptides corresponding to RNMT(RNA (guanine-7-) methyltransferase) The peptide sequence was selected from the N terminal of RNMT. Peptide sequence ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: DKFZp686H1252, EC 2.1.1.56, hcm1p, hCMT1, hCMT1c, hMet, KIAA0398, mRNA (guanine-7-)methyltransferase, mRNA (guanine-N(7)-)-methyltransferase, mRNA cap guanine-N7 methyltransferase, mRNA cap methyltransferase, RG7MT1MET, RNA (guanine-7-) methyltransferase
Gene Symbols: RNMT
Isotype: IgG
Antigen: RBPMS2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene ID (Entrez): 348093
Immunogen: Synthetic peptides corresponding to RBPMS2(RNA binding protein with multiple splicing 2) The peptide sequence was selected from the middle region of RBPMS2. Peptide sequence MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: RNA binding protein with multiple splicing 2, RNA-binding protein with multiple splicing 2
Gene Symbols: RBPMS2
Isotype: IgG
