RASGRP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
RASGRP2
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
Q7LDG7
Gene ID (Entrez)
10235
Immunogen
Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS.
Primary or Secondary
Primary
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
Calcium and DAG-regulated guanine nucleotide exchange factor I, CALDAG-GEFI, CDC25Lcalcium and diacylglycerol-regulated guanine nucleotide exchange factor I, Cdc25-like protein, F25B3.3 kinase-like protein, guanine exchange factor MCG7, hCDC25L, MCG7, RAS guanyl nucleotide-releasing protein 2, RAS guanyl releasing protein 2 (calcium and DAG-regulated), RAS guanyl-releasing protein 2
Gene Symbols
RASGRP2
Isotype
IgG
Related Products
Description
- RASGRP2 Polyclonal specifically detects RASGRP2 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: RASGRP2
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q7LDG7
Gene ID (Entrez): 10235
Immunogen: Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Calcium and DAG-regulated guanine nucleotide exchange factor I, CALDAG-GEFI, CDC25Lcalcium and diacylglycerol-regulated guanine nucleotide exchange factor I, Cdc25-like protein, F25B3.3 kinase-like protein, guanine exchange factor MCG7, hCDC25L, MCG7, RAS guanyl nucleotide-releasing protein 2, RAS guanyl releasing protein 2 (calcium and DAG-regulated), RAS guanyl-releasing protein 2
Gene Symbols: RASGRP2
Isotype: IgG
Antigen: IFIT5
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q13325
Gene ID (Entrez): 24138
Immunogen: Synthetic peptides corresponding to IFIT5(interferon-induced protein with tetratricopeptide repeats 5) The peptide sequence was selected from the middle region of IFIT5. Peptide sequence ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: FLJ53857, IFIT-5, interferon-induced protein with tetratricopeptide repeats 5, Retinoic acid- and interferon-inducible 58 kDa protein, retinoic acid- and interferon-inducible protein (58kD), RI58FLJ92678
Gene Symbols: IFIT5
Isotype: IgG
Antigen: SOCS-7/Nck/NAP4
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: O14512
Gene ID (Entrez): 30837
Immunogen: Synthetic peptides corresponding to SOCS7(suppressor of cytokine signaling 7) The peptide sequence was selected from the N terminal of SOCS7. Peptide sequence LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: NAP-4, NAP4SOCS-7, Nck, Ash and phospholipase C binding protein, Nck, Ash and phospholipase C gamma-binding protein, NCKAP4, Nck-associated protein 4, SOCS6, suppressor of cytokine signaling 7
Gene Symbols: SOCS7
Isotype: IgG
