ZDHHC17 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ZDHHC17
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Accession No.
Q8IUH5
Gene ID (Entrez)
23390
Immunogen
Synthetic peptides corresponding to ZDHHC17(zinc finger, DHHC-type containing 17) The peptide sequence was selected from the middle region of ZDHHC17 (NP_056151). Peptide sequence LFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKP.
Primary or Secondary
Primary
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Signal Transduction
Gene Alias
DHHC-17, EC 2.3.1, EC 2.3.1.-, HIP14HIP-14, huntingtin interacting protein 14, huntingtin interacting protein 3, Huntingtin interacting protein H, Huntingtin yeast partner H, Huntingtin-interacting protein 14, Huntingtin-interacting protein 3, Huntingtin-interacting protein H, HYPHHIP-3, KIAA0946HIP3, palmitoyltransferase ZDHHC17, Putative MAPK-activating protein PM11, Putative NF-kappa-B-activating protein 205, Zinc finger DHHC domain-containing protein 17, zinc finger, DHHC domain containing 17, zinc finger, DHHC-type containing 17
Gene Symbols
ZDHHC17
Isotype
IgG
Molecular Weight of Antigen
73 kDa
Related Products
Description
- ZDHHC17 Polyclonal specifically detects ZDHHC17 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ZDHHC17
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q8IUH5
Gene ID (Entrez): 23390
Immunogen: Synthetic peptides corresponding to ZDHHC17(zinc finger, DHHC-type containing 17) The peptide sequence was selected from the middle region of ZDHHC17 (NP_056151). Peptide sequence LFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKP.
Primary or Secondary: Primary
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Signal Transduction
Gene Alias: DHHC-17, EC 2.3.1, EC 2.3.1.-, HIP14HIP-14, huntingtin interacting protein 14, huntingtin interacting protein 3, Huntingtin interacting protein H, Huntingtin yeast partner H, Huntingtin-interacting protein 14, Huntingtin-interacting protein 3, Huntingtin-interacting protein H, HYPHHIP-3, KIAA0946HIP3, palmitoyltransferase ZDHHC17, Putative MAPK-activating protein PM11, Putative NF-kappa-B-activating protein 205, Zinc finger DHHC domain-containing protein 17, zinc finger, DHHC domain containing 17, zinc finger, DHHC-type containing 17
Gene Symbols: ZDHHC17
Isotype: IgG
Molecular Weight of Antigen: 73 kDa
Antigen: SHISA5
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q8N114
Gene ID (Entrez): 51246
Immunogen: Synthetic peptides corresponding to SCOTIN The peptide sequence was selected from the middle region of SCOTIN. Peptide sequence CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV.
Primary or Secondary: Primary
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: protein shisa-5, Putative NF-kappa-B-activating protein 120, Scotin, SCOTINhShisa5, shisa homolog 5 (Xenopus laevis)
Gene Symbols: SHISA5
Isotype: IgG
Molecular Weight of Antigen: __
Antigen: __
Conjugate: __
Regulatory Status: __
Gene Accession No.: __
Gene ID (Entrez): __
Immunogen: __
Primary or Secondary: __
Classification: __
Host Species: __
Research Discipline: __
Gene Alias: __
Gene Symbols: __
Isotype: __
Molecular Weight of Antigen: __
