SPTLC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
SPTLC1
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
O15269
Gene ID (Entrez)
10558
Immunogen
Synthetic peptides corresponding to SPTLC1(serine palmitoyltransferase, long chain base subunit 1) The peptide sequence was selected from the middle region of SPTLC1. Peptide sequence ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI.
Primary or Secondary
Primary
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
EC 2.3.1.50, hereditary sensory neuropathy, type 1, HSAN1, LBC1, LCB 1, LCB1HSAN, Long chain base biosynthesis protein 1, MGC14645, serine C-palmitoyltransferase, serine palmitoyltransferase 1, serine palmitoyltransferase, long chain base subunit 1, Serine-palmitoyl-CoA transferase 1, SPT 1, SPT1HSN1, SPTI
Gene Symbols
SPTLC1
Isotype
IgG
Molecular Weight of Antigen
53 kDa
Related Products
Description
- SPTLC1 Polyclonal specifically detects SPTLC1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SPTLC1
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: O15269
Gene ID (Entrez): 10558
Immunogen: Synthetic peptides corresponding to SPTLC1(serine palmitoyltransferase, long chain base subunit 1) The peptide sequence was selected from the middle region of SPTLC1. Peptide sequence ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI.
Primary or Secondary: Primary
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: EC 2.3.1.50, hereditary sensory neuropathy, type 1, HSAN1, LBC1, LCB 1, LCB1HSAN, Long chain base biosynthesis protein 1, MGC14645, serine C-palmitoyltransferase, serine palmitoyltransferase 1, serine palmitoyltransferase, long chain base subunit 1, Serine-palmitoyl-CoA transferase 1, SPT 1, SPT1HSN1, SPTI
Gene Symbols: SPTLC1
Isotype: IgG
Molecular Weight of Antigen: 53 kDa
Antigen: CLN6
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q9NWW5
Gene ID (Entrez): 54982
Immunogen: Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the middle region of CLN6. Peptide sequence LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: ceroid-lipofuscinosis neuronal protein 6, ceroid-lipofuscinosis, neuronal 6, late infantile, variant, FLJ20561, HsT18960, nclf, Protein CLN6
Gene Symbols: CLN6
Isotype: IgG
Molecular Weight of Antigen: 36 kDa
Antigen: Synaptophysin
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: B2R7L6
Gene ID (Entrez): 6855
Immunogen: __
Primary or Secondary: Primary
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Major synaptic vesicle protein p38, MRX, MRXSYP, synaptophysin
Gene Symbols: SYP
Isotype: IgG
Molecular Weight of Antigen: 34 kDa
