Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Hydrogen Potassium ATPase Beta
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
P51164
Gene ID (Entrez)
496
Immunogen
Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK.
Primary or Secondary
Primary
Molecular Weight of Antigen
33 kDa
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene Symbols
ATP4B
Isotype
IgG
Test Specificity
This product is specific to Subunit or Isoform: beta.
Related Products
Description
- Hydrogen Potassium ATPase Beta Polyclonal specifically detects Hydrogen Potassium ATPase Beta in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: Hydrogen Potassium ATPase Beta
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: P51164
Gene ID (Entrez): 496
Immunogen: Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK.
Primary or Secondary: Primary
Molecular Weight of Antigen: 33 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene Symbols: ATP4B
Isotype: IgG
Test Specificity: This product is specific to Subunit or Isoform: beta.
Antigen: MARCH2
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q9P0N8
Gene ID (Entrez): 51257
Immunogen: Synthetic peptides corresponding to MARCH2(membrane-associated ring finger (C3HC4) 2) The peptide sequence was selected from the middle region of 40239 (NP_001005415). Peptide sequence LFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLV.
Primary or Secondary: Primary
Molecular Weight of Antigen: 27 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: EC 6.3.2, EC 6.3.2.-, MARCH-IIHSPC240, membrane-associated ring finger (C3HC4) 2, Membrane-associated RING finger protein 2, Membrane-associated RING-CH protein II, RING finger protein 172, RNF172E3 ubiquitin-protein ligase MARCH2
Gene Symbols: 43161
Isotype: IgG
Test Specificity: __
Antigen: Myelin PLP
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: P60201
Gene ID (Entrez): 5354
Immunogen: __
Primary or Secondary: Primary
Molecular Weight of Antigen: __
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: HLD1, lipophilin, major myelin proteolipid protein, MMPL, myelin proteolipid protein, PLP, PLP/DM20, PMD, proteolipid protein 1, spastic paraplegia 2, uncomplicated, SPG2
Gene Symbols: PLP1
Isotype: IgG
Test Specificity: __