Aldo-keto Reductase 1C1/AKR1C1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Aldo-keto Reductase 1C1/AKR1C1
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
20 alpha-hydroxysteroid dehydrogenase, 20-ALPHA-HSD, 20-alpha-hydroxysteroid dehydrogenase, aldo-keto reductase family 1 member C1, aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase), C9, Chlordecone reductase homolog HAKRC, DD1/DD2, DD1MGC8954, DDHH-37, dihydrodiol dehydrogenase 1, Dihydrodiol dehydrogenase 1/2, dihydrodiol dehydrogenase isoform DD1, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.112, EC 1.1.1.149,2-ALPHA-HSD, EC 1.3.1.20, HAKRCDDH1aldo-keto reductase C, HBAB, hepatic dihydrodiol dehydrogenase, High-affinity hepatic bile acid-binding protein, Indanol dehydrogenase, MBAB, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II 3-alpha-hydroxysteroid dehydrogenase
Gene Symbols
AKR1C1
Isotype
IgG
Molecular Weight of Antigen
36 kDa
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
Q04828
Gene ID (Entrez)
1645
Immunogen
Synthetic peptide directed towards the N terminal of human AKR1C1 (NP_001344). Peptide sequence: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
Primary or Secondary
Primary
Description
- Aldo-keto Reductase 1C1/AKR1C1 Polyclonal specifically detects Aldo-keto Reductase 1C1/AKR1C1 in Human, Monkey samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Aldo-keto Reductase 1C1/AKR1C1
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: 20 alpha-hydroxysteroid dehydrogenase, 20-ALPHA-HSD, 20-alpha-hydroxysteroid dehydrogenase, aldo-keto reductase family 1 member C1, aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase), C9, Chlordecone reductase homolog HAKRC, DD1/DD2, DD1MGC8954, DDHH-37, dihydrodiol dehydrogenase 1, Dihydrodiol dehydrogenase 1/2, dihydrodiol dehydrogenase isoform DD1, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.112, EC 1.1.1.149,2-ALPHA-HSD, EC 1.3.1.20, HAKRCDDH1aldo-keto reductase C, HBAB, hepatic dihydrodiol dehydrogenase, High-affinity hepatic bile acid-binding protein, Indanol dehydrogenase, MBAB, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II 3-alpha-hydroxysteroid dehydrogenase
Gene Symbols: AKR1C1
Isotype: IgG
Molecular Weight of Antigen: 36 kDa
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q04828
Gene ID (Entrez): 1645
Immunogen: Synthetic peptide directed towards the N terminal of human AKR1C1 (NP_001344). Peptide sequence: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
Primary or Secondary: Primary
Antigen: CYP11B1
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: CPN1, CYPXIB1, cytochrome P450 11B1, mitochondrial, cytochrome p450 XIB1, cytochrome P450, family 11, subfamily B, polypeptide 1, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1, Cytochrome P-450c11, Cytochrome P450C11, EC 1.14.15, EC 1.14.15.4, FHICYP11B, FLJ36771, P450C11DKFZp686B05283, S11BH, Steroid 11-beta-hydroxylase, steroid 11-beta-monooxygenase
Gene Symbols: CYP11B1
Isotype: IgG
Molecular Weight of Antigen: 55 kDa
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: P15538
Gene ID (Entrez): 1584
Immunogen: Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the C terminal of CYP11B1. Peptide sequence ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL.
Primary or Secondary: Primary
Antigen: CYP8B1
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: CP8B, CYP127 alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase, CYPVIIIB1, Cytochrome P450 8B1, cytochrome P450, family 8, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIIB (sterol 12-alpha-hydroxylase), polypeptide 1,7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase, EC 1.14.13.95, FLJ17826,7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase, Sterol 12-alpha-hydroxylase
Gene Symbols: CYP8B1
Isotype: IgG
Molecular Weight of Antigen: 58 kDa
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q9UNU6
Gene ID (Entrez): 1582
Immunogen: Synthetic peptides corresponding to CYP8B1 (cytochrome P450, family 8, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP8B1. Peptide sequence SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP.
Primary or Secondary: Primary
