Cytochrome P450 3A5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Cytochrome P450 3A5
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Lipid and Metabolism
Gene Alias
aryl hydrocarbon hydroxylase, CP35, CYPIIIA5, cytochrome P-450, cytochrome P450 3A5, Cytochrome P450 HLp2, cytochrome P450, family 3, subfamily A, polypeptide 5, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5, Cytochrome P450-PCN3, DKFZp686L16231, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, niphedipine oxidase, P450PCN3FLJ31317, PCN3, xenobiotic monooxygenase
Gene Symbols
CYP3A5
Isotype
IgG
Molecular Weight of Antigen
57 kDa
Applications
Western Blot, Immunohistochemistry
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Accession No.
P51589
Gene ID (Entrez)
1577
Immunogen
Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL.
Primary or Secondary
Primary
Related Products
Description
- Cytochrome P450 3A5 Polyclonal specifically detects Cytochrome P450 3A5 in Human samples
- It is validated for Western Blot, Immunohistochemistry.
Compare Similar Items
Show Difference
Antigen: Cytochrome P450 3A5
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Lipid and Metabolism
Gene Alias: aryl hydrocarbon hydroxylase, CP35, CYPIIIA5, cytochrome P-450, cytochrome P450 3A5, Cytochrome P450 HLp2, cytochrome P450, family 3, subfamily A, polypeptide 5, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5, Cytochrome P450-PCN3, DKFZp686L16231, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, niphedipine oxidase, P450PCN3FLJ31317, PCN3, xenobiotic monooxygenase
Gene Symbols: CYP3A5
Isotype: IgG
Molecular Weight of Antigen: 57 kDa
Applications: Western Blot, Immunohistochemistry
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: P51589
Gene ID (Entrez): 1577
Immunogen: Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL.
Primary or Secondary: Primary
Antigen: XAGE2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: Cancer/testis antigen 12.2, cancer/testis antigen family 12, member 2, CT12.2GAGED3, G antigen family D member 3, G antigen, family D, 3, Protein XAGE-2, X antigen family, member 2, XAGE-2, XAGE2B
Gene Symbols: XAGE2
Isotype: IgG
Molecular Weight of Antigen: 12 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q96GT9
Gene ID (Entrez): 9502
Immunogen: Synthetic peptides corresponding to XAGE2 (X antigen family, member 2) The peptide sequence was selected from the middle region of XAGE2. Peptide sequence KSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGK.
Primary or Secondary: Primary
Antigen: TMCO4
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: DKFZp686C23231, RP5-1056L3.6, transmembrane and coiled-coil domain-containing protein 4, transmembrane and coiled-coil domains 4
Gene Symbols: TMCO4
Isotype: IgG
Molecular Weight of Antigen: 68 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q5TGY1
Gene ID (Entrez): 255104
Immunogen: Synthetic peptides corresponding to TMCO4 (transmembrane and coiled-coil domains 4) The peptide sequence was selected from the C terminal of TMCO4. Peptide sequence WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS.
Primary or Secondary: Primary