ZEB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ZEB1
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Accession No.
P37275
Gene ID (Entrez)
6935
Immunogen
Synthetic peptides corresponding to ZEB1 (zinc finger E-box binding homeobox 1) The peptide sequence was selected from the N terminal of ZEB1. Peptide sequence NPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPT.
Primary or Secondary
Primary
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cancer, Chromatin Research, Signal Transduction, Transcription Factors and Regulators, Zinc Finger
Gene Alias
AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein
Gene Symbols
ZEB1
Isotype
IgG
Molecular Weight of Antigen
124 kDa
Description
- ZEB1 Polyclonal specifically detects ZEB1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ZEB1
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: P37275
Gene ID (Entrez): 6935
Immunogen: Synthetic peptides corresponding to ZEB1 (zinc finger E-box binding homeobox 1) The peptide sequence was selected from the N terminal of ZEB1. Peptide sequence NPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPT.
Primary or Secondary: Primary
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cancer, Chromatin Research, Signal Transduction, Transcription Factors and Regulators, Zinc Finger
Gene Alias: AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein
Gene Symbols: ZEB1
Isotype: IgG
Molecular Weight of Antigen: 124 kDa
Antigen: __
Conjugate: __
Regulatory Status: __
Gene Accession No.: __
Gene ID (Entrez): __
Immunogen: __
Primary or Secondary: __
Classification: __
Host Species: __
Research Discipline: __
Gene Alias: __
Gene Symbols: __
Isotype: __
Molecular Weight of Antigen: __
Antigen: COL9A3
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Accession No.: Q14050
Gene ID (Entrez): 1299
Immunogen: Synthetic peptides corresponding to COL9A3 (collagen, type IX, alpha 3) The peptide sequence was selected from the C terminal of COL9A3. Peptide sequence PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP.
Primary or Secondary: Primary
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: collagen type IX proteoglycan, collagen, type IX, alpha 3, DJ885L7.4.1, EDM3collagen alpha-3(IX) chain, FLJ90759, IDDcollagen IX, alpha-3 polypeptide, MED
Gene Symbols: COL9A3
Isotype: IgG
Molecular Weight of Antigen: 63 kDa