BASP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
BASP1
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
P80723
Gene ID (Entrez)
10409
Immunogen
Synthetic peptides corresponding to BASP1 (brain abundant, membrane attached signal protein 1) The peptide sequence was selected from the C terminal of BASP1. Peptide sequence APAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSS.
Primary or Secondary
Primary
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
brain abundant, membrane attached signal protein 1,22 kDa neuronal tissue-enriched acidic protein, brain acid-soluble protein 1, CAP-23, CAP23brain acid soluble protein 1, NAP-22, NAP22MGC8555, Neuronal axonal membrane protein NAP-22, neuronal tissue-enriched acidic protein
Gene Symbols
BASP1
Isotype
IgG
Molecular Weight of Antigen
23 kDa
Related Products
Description
- BASP1 Polyclonal specifically detects BASP1 in Human, Rat samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: BASP1
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: P80723
Gene ID (Entrez): 10409
Immunogen: Synthetic peptides corresponding to BASP1 (brain abundant, membrane attached signal protein 1) The peptide sequence was selected from the C terminal of BASP1. Peptide sequence APAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSS.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: brain abundant, membrane attached signal protein 1,22 kDa neuronal tissue-enriched acidic protein, brain acid-soluble protein 1, CAP-23, CAP23brain acid soluble protein 1, NAP-22, NAP22MGC8555, Neuronal axonal membrane protein NAP-22, neuronal tissue-enriched acidic protein
Gene Symbols: BASP1
Isotype: IgG
Molecular Weight of Antigen: 23 kDa
Antigen: CACNA2D4
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q7Z3S7
Gene ID (Entrez): 93589
Immunogen: __
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: calcium channel, voltage-dependent, alpha 2/delta subunit 4, RCD4, voltage-dependent calcium channel subunit alpha-2/delta-4, voltage-gated calcium channel alpha(2)delta-4 subunit, Voltage-gated calcium channel subunit alpha-2/delta-4
Gene Symbols: CACNA2D4
Isotype: IgG
Molecular Weight of Antigen: 128 kDa
Antigen: BBS10
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q8TAM1
Gene ID (Entrez): 79738
Immunogen: Synthetic peptides corresponding to BBS10 (Bardet-Biedl syndrome 10) The peptide sequence was selected from the C terminal of BBS10. Peptide sequence SQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Bardet-Biedl syndrome 10, Bardet-Biedl syndrome 10 protein, FLJ23560C12orf58chromosome 12 open reading frame 58
Gene Symbols: BBS10
Isotype: IgG
Molecular Weight of Antigen: 81 kDa
