ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ST6 Gal Sialyltransferase 2/ST6GAL2
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
B2RQY9
Gene ID (Entrez)
84620
Immunogen
Synthetic peptides corresponding to the C terminal of St6gal2. Immunizing peptide sequence RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT.
Primary or Secondary
Primary
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
Alpha 2,6-ST 2, beta-galactoside alpha-2,6-sialyltransferase 2, beta-galactoside alpha-2,6-sialyltransferase II, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2, EC 2.4.99, EC 2.4.99.1, FLJ30711, FLJ37730, FLJ38334, hST6Gal II, KIAA1877St6gal2, Sialyltransferase 2, sialyltransferase 2 (monosialoganglioside sialyltransferase), SIAT2, ST6 beta-galactosamide alpha-2,6-sialyltranferase 2, ST6Gal II, ST6GALII
Gene Symbols
ST6GAL2
Isotype
IgG
Description
- ST6 Gal Sialyltransferase 2/ST6GAL2 Polyclonal specifically detects ST6 Gal Sialyltransferase 2/ST6GAL2 in Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ST6 Gal Sialyltransferase 2/ST6GAL2
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: B2RQY9
Gene ID (Entrez): 84620
Immunogen: Synthetic peptides corresponding to the C terminal of St6gal2. Immunizing peptide sequence RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Alpha 2,6-ST 2, beta-galactoside alpha-2,6-sialyltransferase 2, beta-galactoside alpha-2,6-sialyltransferase II, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2, EC 2.4.99, EC 2.4.99.1, FLJ30711, FLJ37730, FLJ38334, hST6Gal II, KIAA1877St6gal2, Sialyltransferase 2, sialyltransferase 2 (monosialoganglioside sialyltransferase), SIAT2, ST6 beta-galactosamide alpha-2,6-sialyltranferase 2, ST6Gal II, ST6GALII
Gene Symbols: ST6GAL2
Isotype: IgG
Antigen: WDR68
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: P61963
Gene ID (Entrez): 10238
Immunogen: Synthetic peptides corresponding to the N terminal of Dcaf7. Immunizing peptide sequence SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: DDB1 and CUL4 associated factor 7, DDB1- and CUL4-associated factor 7, HAN11AN11, human anthocyanin, seven-WD-repeat protein of the AN11 family-1, SWAN-1, WD repeat domain 68, WD repeat-containing protein 68, WD repeat-containing protein An11 homolog, WDR68, WD-repeat protein
Gene Symbols: DCAF7
Isotype: IgG
Antigen: WDR68
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: P61963
Gene ID (Entrez): 10238
Immunogen: Synthetic peptides corresponding to the N terminal of Dcaf7. Immunizing peptide sequence SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: DDB1 and CUL4 associated factor 7, DDB1- and CUL4-associated factor 7, HAN11AN11, human anthocyanin, seven-WD-repeat protein of the AN11 family-1, SWAN-1, WD repeat domain 68, WD repeat-containing protein 68, WD repeat-containing protein An11 homolog, WDR68, WD-repeat protein
Gene Symbols: DCAF7
Isotype: IgG
