PPP2R5E Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
PPP2R5E
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
Q61151
Gene ID (Entrez)
5529
Immunogen
Synthetic peptides corresponding to the N terminal of Ppp2r5e. Immunizing peptide sequence SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP.
Primary or Secondary
Primary
Molecular Weight of Antigen
51 kDa
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
epsilon isoform of regulatory subunit B56, protein phosphatase 2A, PP2A B subunit isoform B56-epsilon, PP2A B subunit isoform B'-epsilon, PP2A B subunit isoform PR61-epsilon, PP2A B subunit isoform R5-epsilon, PP2A, B subunit, B' epsilon, PP2A, B subunit, B56 epsilon, PP2A, B subunit, PR61 epsilon, PP2A, B subunit, R5 epsilon, protein phosphatase 2, regulatory subunit B (B56), epsilon isoform, protein phosphatase 2, regulatory subunit B', epsilon isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform
Gene Symbols
PPP2R5E
Isotype
IgG
Test Specificity
This product is specific to Subunit or Isoform: epsilon isoform.
Description
- PPP2R5E Polyclonal specifically detects PPP2R5E in Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: PPP2R5E
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q61151
Gene ID (Entrez): 5529
Immunogen: Synthetic peptides corresponding to the N terminal of Ppp2r5e. Immunizing peptide sequence SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP.
Primary or Secondary: Primary
Molecular Weight of Antigen: 51 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: epsilon isoform of regulatory subunit B56, protein phosphatase 2A, PP2A B subunit isoform B56-epsilon, PP2A B subunit isoform B'-epsilon, PP2A B subunit isoform PR61-epsilon, PP2A B subunit isoform R5-epsilon, PP2A, B subunit, B' epsilon, PP2A, B subunit, B56 epsilon, PP2A, B subunit, PR61 epsilon, PP2A, B subunit, R5 epsilon, protein phosphatase 2, regulatory subunit B (B56), epsilon isoform, protein phosphatase 2, regulatory subunit B', epsilon isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform
Gene Symbols: PPP2R5E
Isotype: IgG
Test Specificity: This product is specific to Subunit or Isoform: epsilon isoform.
Antigen: TDP1
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: __
Gene ID (Entrez): 55775
Immunogen: Synthetic peptides corresponding to the middle region of Tdp1. Immunizing peptide sequence ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF.
Primary or Secondary: Primary
Molecular Weight of Antigen: 64 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: EC 3.1.4, EC 3.1.4.-, FLJ11090, MGC104252, SCAN1, Tyr-DNA phosphodiesterase 1, tyrosyl-DNA phosphodiesterase 1
Gene Symbols: TDP1
Isotype: IgG
Test Specificity: __
Antigen: HAND2
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q61039
Gene ID (Entrez): 9464
Immunogen: Synthetic peptides corresponding to the C terminal of Hand2. Immunizing peptide sequence DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ.
Primary or Secondary: Primary
Molecular Weight of Antigen: 24 kDa
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2
Gene Symbols: HAND2
Isotype: IgG
Test Specificity: __
