BRF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
BRF1
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
NP_082469
Gene ID (Entrez)
2972
Immunogen
Synthetic peptide directed towards the C terminal of mouse BRF1. Peptide sequence GSPPRDDSQPPERASTKKLSRRKRATTRNSADPGTSTGKRLRPLLSAQPA.
Primary or Secondary
Primary
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit
Gene Symbols
BRF1
Isotype
IgG
Description
- BRF1 Polyclonal specifically detects BRF1 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: BRF1
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: NP_082469
Gene ID (Entrez): 2972
Immunogen: Synthetic peptide directed towards the C terminal of mouse BRF1. Peptide sequence GSPPRDDSQPPERASTKKLSRRKRATTRNSADPGTSTGKRLRPLLSAQPA.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit
Gene Symbols: BRF1
Isotype: IgG
Antigen: UPF2
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: Q9HAU5
Gene ID (Entrez): 26019
Immunogen: Synthetic peptide directed towards the N terminal of human UPF2 (NP_056357). Peptide sequence KAPEDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEE.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: DKFZP434D222, hUpf2, KIAA1408MGC138835, Nonsense mRNA reducing factor 2, regulator of nonsense transcripts 2, RENT2MGC138834, smg-3, UPF2 regulator of nonsense transcripts homolog (yeast), Up-frameshift suppressor 2 homolog, yeast Upf2p homolog
Gene Symbols: UPF2
Isotype: IgG
Antigen: RBM18
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: NP_149108
Gene ID (Entrez): 92400
Immunogen: Synthetic peptide directed towards the middle region of human RBM18. Peptide sequence VRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKL.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: MGC2734, RNA binding motif protein 18, RNA-binding motif protein 18
Gene Symbols: RBM18
Isotype: IgG