MED7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
MED7
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
Activator-recruited cofactor 34 kDa component, Cofactor required for Sp1 transcriptional activation subunit 9, cofactor required for Sp1 transcriptional activation, subunit 9 (33kD), cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa, CRSP33CRSP complex subunit 9, CRSP9hMED7, mediator complex subunit 7ARC34, mediator of RNA polymerase II transcription subunit 7, MGC12284, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33
Gene Symbols
MED7
Isotype
IgG
Molecular Weight of Antigen
27 kDa
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
NP_004261
Gene ID (Entrez)
9443
Immunogen
The immunogen for this antibody is MED7 - C-terminal region. Peptide sequence LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE.
Primary or Secondary
Primary
Related Products
Description
- Description MED7 Polyclonal specifically detects MED7 in Human samples
- It is validated for Western Blot, Chromatin Immunoprecipitation, Chromatin Immunoprecipitation (ChIP).
Compare Similar Items
Show Difference
Antigen: MED7
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Activator-recruited cofactor 34 kDa component, Cofactor required for Sp1 transcriptional activation subunit 9, cofactor required for Sp1 transcriptional activation, subunit 9 (33kD), cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa, CRSP33CRSP complex subunit 9, CRSP9hMED7, mediator complex subunit 7ARC34, mediator of RNA polymerase II transcription subunit 7, MGC12284, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33
Gene Symbols: MED7
Isotype: IgG
Molecular Weight of Antigen: 27 kDa
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: NP_004261
Gene ID (Entrez): 9443
Immunogen: The immunogen for this antibody is MED7 - C-terminal region. Peptide sequence LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE.
Primary or Secondary: Primary
Antigen: EYA1
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: BOP, BOR, EC 3.1.3.48, eyes absent (Drosophila) homolog 1, eyes absent homolog 1, eyes absent homolog 1 (Drosophila), MGC141875
Gene Symbols: EYA1
Isotype: IgG
Molecular Weight of Antigen: 64 kDa
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: NP_034294
Gene ID (Entrez): 2138
Immunogen: The immunogen for this antibody is Eya1 - middle region. Peptide sequence SGFNSSQQDYPSYPGFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNAT.
Primary or Secondary: Primary
Antigen: ZBTB12
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: C6orf46, chromosome 6 open reading frame 46, D6S59E, G10Bat9, NG35HLA-B-associated transcript 9, Protein G10, zinc finger and BTB domain containing 12, zinc finger and BTB domain-containing protein 12
Gene Symbols: ZBTB12
Isotype: IgG
Molecular Weight of Antigen: 50 kDa
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: NP_001128463
Gene ID (Entrez): 221527
Immunogen: The immunogen for this antibody is ZBTB12 - middle region. Peptide sequence KLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVAHRLKPPGGLA.
Primary or Secondary: Primary
