Reg1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Reg1
Classification
Polyclonal
Host Species
Rabbit
Gene Accession No.
NP_033068
Gene ID (Entrez)
5967
Immunogen
The immunogen for this antibody is Reg1 - middle region. Peptide sequence LHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKD.
Primary or Secondary
Primary
Applications
Western Blot
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
ICRF, Islet cells regeneration factor, Islet of Langerhans regenerating protein, lithostathine-1-alpha, Pancreatic stone protein, pancreatic stone protein, secretory, Pancreatic thread protein, protein-X, PSPregenerating islet-derived 1 alpha (pancreatic stone protein, pancreatic threadprotein), PSPS1REG-1-alpha, PSPSMGC12447, PTPP19, regenerating islet-derived 1 alpha, Regenerating islet-derived protein 1-alpha, Regenerating protein I alpha, REGlithostathine 1 alpha
Gene Symbols
REG1A
Isotype
IgG
Molecular Weight of Antigen
165 kDa
Related Products
Description
- Reg1A Polyclonal specifically detects Reg1A in Human, Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: Reg1
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: NP_033068
Gene ID (Entrez): 5967
Immunogen: The immunogen for this antibody is Reg1 - middle region. Peptide sequence LHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKD.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: ICRF, Islet cells regeneration factor, Islet of Langerhans regenerating protein, lithostathine-1-alpha, Pancreatic stone protein, pancreatic stone protein, secretory, Pancreatic thread protein, protein-X, PSPregenerating islet-derived 1 alpha (pancreatic stone protein, pancreatic threadprotein), PSPS1REG-1-alpha, PSPSMGC12447, PTPP19, regenerating islet-derived 1 alpha, Regenerating islet-derived protein 1-alpha, Regenerating protein I alpha, REGlithostathine 1 alpha
Gene Symbols: REG1A
Isotype: IgG
Molecular Weight of Antigen: 165 kDa
Antigen: Opsin 1 (Medium Wave)
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: NP_032132
Gene ID (Entrez): 2652
Immunogen: The immunogen for this antibody is Opsin 1 (Medium Wave) - C-terminal region. Peptide sequence CYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFF.
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: GCP, GOP, Green cone photoreceptor pigment, Green-sensitive opsin, medium-wave-sensitive opsin 1, OPN1MW, opsin 1 (cone pigments), medium-wave-sensitive 2
Gene Symbols: OPN1MW
Isotype: IgG
Molecular Weight of Antigen: 40 kDa
Antigen: ARL1
Classification: Polyclonal
Host Species: Rabbit
Gene Accession No.: NP_001168
Gene ID (Entrez): 400
Immunogen: The immunogen for this antibody is ARL1 - C-terminal region. Peptide sequence: SKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRK
Primary or Secondary: Primary
Applications: Western Blot
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: ADP-ribosylation factor-like 1, ADP-ribosylation factor-like protein 1, ARFL1
Gene Symbols: ARL1
Isotype: IgG
Molecular Weight of Antigen: 20 kDa
