AKAP7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
AKAP7
Applications
Immunofluorescence
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
Stem Cell Markers
Formulation
PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)
9465
Isotype
IgG
Purification Method
Affinity purified
Dilution
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification
Polyclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human
Gene Alias
A kinase (PRKA) anchor protein 7, AKAP 18, AKAP15, AKAP18A-kinase anchor protein 7 isoform alpha, AKAP-7 isoform gamma, AKAP-7 isoforms alpha and beta, A-kinase anchor protein 18 kDa, A-kinase anchor protein 7, A-kinase anchor protein 7 isoform gamma, A-kinase anchor protein 7 isoforms alpha and beta, A-kinase anchor protein 9 kDa, A-kinase anchor protein, 18-kD, A-kinase anchoring protein 18, protein kinase A anchoring protein 7, Protein kinase A-anchoring protein 7 isoform gamma, Protein kinase A-anchoring protein 7 isoforms alpha/beta
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGD
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- AKAP7 Polyclonal antibody specifically detects AKAP7 in Human samples
- It is validated for Immunofluorescence
Compare Similar Items
Show Difference
Antigen: AKAP7
Applications: Immunofluorescence
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Stem Cell Markers
Formulation: PBS, pH 7.2, 40% glycerol
Gene ID (Entrez): 9465
Isotype: IgG
Purification Method: Affinity purified
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: A kinase (PRKA) anchor protein 7, AKAP 18, AKAP15, AKAP18A-kinase anchor protein 7 isoform alpha, AKAP-7 isoform gamma, AKAP-7 isoforms alpha and beta, A-kinase anchor protein 18 kDa, A-kinase anchor protein 7, A-kinase anchor protein 7 isoform gamma, A-kinase anchor protein 7 isoforms alpha and beta, A-kinase anchor protein 9 kDa, A-kinase anchor protein, 18-kD, A-kinase anchoring protein 18, protein kinase A anchoring protein 7, Protein kinase A-anchoring protein 7 isoform gamma, Protein kinase A-anchoring protein 7 isoforms alpha/beta
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGD
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: Cannabinoid R1/CB1/CNR1
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cancer, GPCR, Neuroscience, Neurotransmission, Vision
Formulation: PBS, pH 7.2, 40% glycerol
Gene ID (Entrez): 1268
Isotype: IgG
Purification Method: Affinity purified
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: CANN6CB1R, cannabinoid receptor 1 (brain), CB1A, CB1K5, CB-RCB1cannabinoid receptor 1, central cannabinoid receptor, CNR
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: CRYGS
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Neuroscience
Formulation: PBS, pH 7.2, 40% glycerol
Gene ID (Entrez): 1427
Isotype: IgG
Purification Method: Affinity purified
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: beta-crystallin S, CRYG8, crystallin, gamma 8, crystallin, gamma S, Gamma-crystallin S, gamma-S-crystallin, GRYG8
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKV
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.