IL-33 Mouse anti-Human, Clone: IL33305B, Novus Biologicals™
Mouse Monoclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
IL-33
Concentration
1 mg/ml
Applications
Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), ELISA, Neutralization
Conjugate
Unconjugated
Host Species
Mouse
Research Discipline
Biologically Active Proteins, Cellular Markers, Core ESC Like Genes, Immunology, Inflammation, Innate Immunity, Neuroscience, Sensory Systems, Stem Cell Markers, Stem Cells, Transcription Factors and Regulators, Vision
Formulation
0.2 um-filtered solution in PBS, pH 7.4
Gene ID (Entrez)
90865
Isotype
IgG2a κ
Purification Method
Protein G purified
Clone
IL33305B
Dilution
Western Blot 1:2000-1:5000, ELISA 1:2000-1:5000, Immunohistochemistry 1:50-1:200, Immunoprecipitation, Immunohistochemistry-Paraffin 1:50-1:200, Direct ELISA 1:2000-1:5000, Block/Neutralize
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human
Gene Alias
C9orf26chromosome 9 open reading frame 26 (NF-HEV), DKFZp586H0523, DVS27, DVS27-related protein, IL1F11, IL-1F11, IL-33, interleukin 33, Interleukin-1 family member 11, interleukin-33, NFHEV, NF-HEVNFEHEV, Nuclear factor from high endothelial venules, RP11-575C20.2
Immunogen
Recombinant human IL-33.
Primary or Secondary
Primary
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Description
- IL-33 Monoclonal specifically detects IL-33 in Human samples
- It is validated for Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin, Direct ELISA, Block/Neutralize.
Compare Similar Items
Show Difference
Antigen: IL-33
Concentration: 1 mg/ml
Applications: Western Blot, ELISA, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), ELISA, Neutralization
Conjugate: Unconjugated
Host Species: Mouse
Research Discipline: Biologically Active Proteins, Cellular Markers, Core ESC Like Genes, Immunology, Inflammation, Innate Immunity, Neuroscience, Sensory Systems, Stem Cell Markers, Stem Cells, Transcription Factors and Regulators, Vision
Formulation: 0.2 um-filtered solution in PBS, pH 7.4
Gene ID (Entrez): 90865
Isotype: IgG2a κ
Purification Method: Protein G purified
Clone: IL33305B
Dilution: Western Blot 1:2000-1:5000, ELISA 1:2000-1:5000, Immunohistochemistry 1:50-1:200, Immunoprecipitation, Immunohistochemistry-Paraffin 1:50-1:200, Direct ELISA 1:2000-1:5000, Block/Neutralize
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: C9orf26chromosome 9 open reading frame 26 (NF-HEV), DKFZp586H0523, DVS27, DVS27-related protein, IL1F11, IL-1F11, IL-33, interleukin 33, Interleukin-1 family member 11, interleukin-33, NFHEV, NF-HEVNFEHEV, Nuclear factor from high endothelial venules, RP11-575C20.2
Immunogen: Recombinant human IL-33.
Primary or Secondary: Primary
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: RTEL1
Concentration: __
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cancer, DNA Repair
Formulation: PBS buffer, 2% sucrose
Gene ID (Entrez): 51750
Isotype: __
Purification Method: Affinity purified
Clone: __
Dilution: Western Blot 1.0 ug/ml
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: C20orf41, regulator of telomere elongation helicase 1, regulator of telomere length
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RTEL1 (NP_057518.1). Peptide sequence HLNQGRPHLSPRPPPTGDPGSQPQWGSGVPRAGKQGQHAVSAYLADARRA
Primary or Secondary: Primary
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: OR14I1
Concentration: __
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: __
Formulation: PBS buffer, 2% sucrose
Gene ID (Entrez): 401994
Isotype: __
Purification Method: Affinity purified
Clone: __
Dilution: Western Blot 1.0 ug/ml
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: olfactory receptor 14I1, Olfactory receptor 5BU1, olfactory receptor, family 14, subfamily I, member 1, olfactory receptor, family 5, subfamily BU, member 1, olfactory receptor, family 5, subfamily BU, member 1 pseudogene, OR5BU1, OR5BU1P
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR14I1. Peptide sequence LGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCSPQLIVIMLFLTTGLF
Primary or Secondary: Primary
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.