dsRNA Mouse anti-Broad Species Reactivity, Clone: K1, Novus Biologicals™
Mouse Monoclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
dsRNA
Concentration
LYOPH
Applications
Flow Cytometry, ELISA, Immunohistochemistry, Immunofluorescence, Immunoblot, Affinity Purification
Conjugate
Unconjugated
Host Species
Mouse
Target Species
Multi-species
Gene Alias
Double-stranded RNA
Isotype
IgG2a κ
Purification Method
Protein A purified
Content And Storage
Store lyophilized antibody at 4°C. Aliquot reconstituted liquid and store at -20°C. Avoid freeze-thaw cycles.
Clone
K1
Dilution
Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoblotting, Immunoaffinity Purification
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Formulation
Lyophilised from PBS
Immunogen
Female DBA/2 mice were injected intraperitonially with a mixture of 50 ug L-dsRNA and 75 ug methylated bovine serum albumin, emulsified in complete Freund's adjuvant. After several boosts spleen cells were fused with Sp2/0-Agl4 myeloma cells to generate the hybridoma clone.
Primary or Secondary
Primary
Reconstitution
The lyophilised sample should be reconstituted with 200 ul (500 ul for 500 ug size) sterile distilled water. The mAb will then be in PBS without any stabilisers or preservatives at a concentration of 1 mg/ml.
Description
- dsRNA Monoclonal antibody specifically detects dsRNA in Broad Species Reactivity samples
- It is validated for Flow Cytometry, ELISA, Immunohistochemistry, Immunofluorescence, Immunoblot, Affinity Purification
Compare Similar Items
Show Difference
Antigen: dsRNA
Concentration: LYOPH
Applications: Flow Cytometry, ELISA, Immunohistochemistry, Immunofluorescence, Immunoblot, Affinity Purification
Conjugate: Unconjugated
Host Species: Mouse
Target Species: Multi-species
Gene Alias: Double-stranded RNA
Isotype: IgG2a κ
Purification Method: Protein A purified
Content And Storage: Store lyophilized antibody at 4°C. Aliquot reconstituted liquid and store at -20°C. Avoid freeze-thaw cycles.
Clone: K1
Dilution: Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoblotting, Immunoaffinity Purification
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Formulation: Lyophilised from PBS
Immunogen: Female DBA/2 mice were injected intraperitonially with a mixture of 50 ug L-dsRNA and 75 ug methylated bovine serum albumin, emulsified in complete Freund's adjuvant. After several boosts spleen cells were fused with Sp2/0-Agl4 myeloma cells to generate the hybridoma clone.
Primary or Secondary: Primary
Reconstitution: The lyophilised sample should be reconstituted with 200 ul (500 ul for 500 ug size) sterile distilled water. The mAb will then be in PBS without any stabilisers or preservatives at a concentration of 1 mg/ml.
Antigen: SCUBE3
Concentration: __
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Target Species: Human
Gene Alias: CEGF3, CUB and EGF containing protein 3, CUB domain and EGF-like repeat containing 3, DKFZp686B09105, DKFZp686B1223, DKFZp686D20108, FLJ34743, signal peptide, CUB and EGF-like domain containing protein 3, signal peptide, CUB and EGF-like domain-containing protein 3, signal peptide, CUB domain, EGF-like 3
Isotype: __
Purification Method: Affinity purified
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Clone: __
Dilution: Western Blot 1.0 ug/ml
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Formulation: PBS buffer, 2% sucrose
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCUBE3 (BAC03798). Peptide sequence MNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGC
Primary or Secondary: Primary
Reconstitution: __
Antigen: __
Concentration: __
Applications: __
Conjugate: __
Host Species: __
Target Species: __
Gene Alias: __
Isotype: __
Purification Method: __
Content And Storage: __
Clone: __
Dilution: __
Classification: __
Form: __
Regulatory Status: __
Formulation: __
Immunogen: __
Primary or Secondary: __
Reconstitution: __