Applications:
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Research Discipline:
Golgi Apparatus Markers, Membrane Trafficking and Chaperones
Formulation:
PBS, 0.05% BSA, 50% glycerol, pH7.3
Purification Method:
Affinity purified
Classification:
Monoclonal
Target Species:
Human, Mouse, Rat
Gene Alias:
Adapter-related protein complex 1 subunit gamma-1, Adaptor protein complex AP-1 subunit gamma-1, adaptor-related protein complex 1, gamma 1 subunit, ADTGclathrin assembly protein complex 1 gamma large chain, AP-1 complex subunit gamma-1, CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1, Clathrin assembly protein complex 1 gamma-1 large chain, gamma adaptin, gamma1-adaptin, golgi adaptor HA1/AP1 adaptin gamma subunit, Golgi adaptor HA1/AP1 adaptin subunit gamma-1, MGC18255
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 723-822 of human Gamma Adaptin (O43747). RSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
Primary or Secondary:
Primary
Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.