MCM3 Rabbit anti-Human, Mouse, Rat, Clone: 9Z5W4, Novus Biologicals™
Rabbit Monoclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
MCM3
Dilution
Western Blot, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human, Mouse, Rat
Gene Alias
cervical cancer proto-oncogene 5, DNA polymerase alpha holoenzyme-associated protein P1, DNA replication factor MCM3, DNA replication licensing factor MCM3, EC 3.6.4.12, HCC5, hRlf beta subunit, MCM3 minichromosome maintenance deficient 3, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), MGC1157, minichromosome maintenance complex component 3, minichromosome maintenance deficient (S. cerevisiae) 3, minichromosome maintenance deficient 3, P1.h, p102, P1-MCM3, replication licensing factor, beta subunit, RLF subunit beta, RLFB
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205).
Primary or Secondary
Primary
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Clone
9Z5W4
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
Cancer, Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Formulation
PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez)
4172
Isotype
IgG
Purification Method
Affinity purified
Related Products
Description
- Description MCM3 Monoclonal antibody specifically detects MCM3 in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: MCM3
Dilution: Western Blot, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: cervical cancer proto-oncogene 5, DNA polymerase alpha holoenzyme-associated protein P1, DNA replication factor MCM3, DNA replication licensing factor MCM3, EC 3.6.4.12, HCC5, hRlf beta subunit, MCM3 minichromosome maintenance deficient 3, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), MGC1157, minichromosome maintenance complex component 3, minichromosome maintenance deficient (S. cerevisiae) 3, minichromosome maintenance deficient 3, P1.h, p102, P1-MCM3, replication licensing factor, beta subunit, RLF subunit beta, RLFB
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205).
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 9Z5W4
Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cancer, Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 4172
Isotype: IgG
Purification Method: Affinity purified
Antigen: MATH1
Dilution: __
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: ATH1protein atonal homolog 1, atonal homolog 1 (Drosophila), BHLHA14, bHLHa14Math1, Class A basic helix-loop-helix protein 14, hATH1, Helix-loop-helix protein hATH-1, MATH-1
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MATH1 (Q92858).
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 7N3G2
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cancer
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 474
Isotype: IgG
Purification Method: Affinity purified
Antigen: Chymase/CMA1/Mast Cell Chymase
Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 2O4P8
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 1215
Isotype: IgG
Purification Method: Affinity purified