Integrin alpha 5/CD49e Rabbit anti-Human, Mouse, Rat, Clone: 8F2O6, Novus Biologicals™
Rabbit Monoclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Integrin alpha 5/CD49e
Dilution
Western Blot 1:500 - 1:2000, Flow Cytometry 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human, Mouse, Rat
Gene Alias
CD49 antigen-like family member E, CD49e, CD49e antigen, Fibronectin receptor subunit alpha, fibronectin receptor, alpha subunit, FNRAVLA5A, integrin alpha-5, Integrin alpha-F, integrin, alpha 5 (fibronectin receptor, alpha polypeptide), very late activation protein 5, alpha subunit, VLA-5
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5/CD49e (P08648). HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Primary or Secondary
Primary
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Clone
8F2O6
Applications
Western Blot, Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
CD Markers, Cell Biology, Cytoskeleton Markers, GPCR, Immunology, Signal Transduction, Stem Cells
Formulation
PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez)
3678
Isotype
IgG
Purification Method
Affinity purified
Related Products
Description
- Integrin alpha 5/CD49e Monoclonal antibody specifically detects Integrin alpha 5/CD49e in Human, Mouse, Rat samples
- It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: Integrin alpha 5/CD49e
Dilution: Western Blot 1:500 - 1:2000, Flow Cytometry 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: CD49 antigen-like family member E, CD49e, CD49e antigen, Fibronectin receptor subunit alpha, fibronectin receptor, alpha subunit, FNRAVLA5A, integrin alpha-5, Integrin alpha-F, integrin, alpha 5 (fibronectin receptor, alpha polypeptide), very late activation protein 5, alpha subunit, VLA-5
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5/CD49e (P08648). HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 8F2O6
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: CD Markers, Cell Biology, Cytoskeleton Markers, GPCR, Immunology, Signal Transduction, Stem Cells
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 3678
Isotype: IgG
Purification Method: Affinity purified
Antigen: Integrin alpha 6/CD49f
Dilution: __
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: CD49 antigen-like family member F, CD49f, CD49f antigen, DKFZp686J01244, FLJ18737, integrin alpha-6, integrin alpha6B, integrin, alpha 6, ITGA6B, VLA-6
Immunogen: A synthesized peptide derived from human Integrin alpha 6/CD49f (ITGA6/CD49f)
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 4E4K6
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Signal Transduction
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 3655
Isotype: IgG
Purification Method: Affinity purified
Antigen: Integrin alpha 6/CD49f
Dilution: __
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: CD49 antigen-like family member F, CD49f, CD49f antigen, DKFZp686J01244, FLJ18737, integrin alpha-6, integrin alpha6B, integrin, alpha 6, ITGA6B, VLA-6
Immunogen: A synthesized peptide derived from human Integrin alpha 6/CD49f (ITGA6/CD49f)
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Clone: 4E4K6
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Signal Transduction
Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez): 3655
Isotype: IgG
Purification Method: Affinity purified