TAF9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
TAF9
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
DNA replication Transcription Translation and Splicing
Formulation
PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)
6880
Isotype
IgG
Purification Method
Affinity purified
Dilution
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification
Polyclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human
Gene Alias
EC 2.7.4.3, MGC:5067, MGC1603, RNA polymerase II TBP-associated factor subunit G, STAF31/32, TAF2G, TAF9, TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa, TAFII31, TAFII-31, TAFII32, TAFII-32, TAFIID32, transcription initiation factor TFIID 31 kD subunit, Transcription initiation factor TFIID 31 kDa subunit, Transcription initiation factor TFIID 32 kDa subunit, transcription initiation factor TFIID subunit 9
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
Primary or Secondary
Primary
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- TAF9 Polyclonal antibody specifically detects TAF9 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: TAF9
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: DNA replication Transcription Translation and Splicing
Formulation: PBS, pH 7.2, 40% glycerol
Gene ID (Entrez): 6880
Isotype: IgG
Purification Method: Affinity purified
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: EC 2.7.4.3, MGC:5067, MGC1603, RNA polymerase II TBP-associated factor subunit G, STAF31/32, TAF2G, TAF9, TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa, TAFII31, TAFII-31, TAFII32, TAFII-32, TAFIID32, transcription initiation factor TFIID 31 kD subunit, Transcription initiation factor TFIID 31 kDa subunit, Transcription initiation factor TFIID 32 kDa subunit, transcription initiation factor TFIID subunit 9
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
Primary or Secondary: Primary
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: TAS2R5
Applications: Immunofluorescence
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: GPCR
Formulation: PBS, pH 7.2, 40% glycerol
Gene ID (Entrez): 54429
Isotype: IgG
Purification Method: Affinity purified
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: taste receptor, type 2, member 5
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLYTHHKKMKVHSAGRRDVRAKAHI
Primary or Secondary: Primary
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: TAS2R5
Applications: Immunofluorescence
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: GPCR
Formulation: PBS, pH 7.2, 40% glycerol
Gene ID (Entrez): 54429
Isotype: IgG
Purification Method: Affinity purified
Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: taste receptor, type 2, member 5
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLYTHHKKMKVHSAGRRDVRAKAHI
Primary or Secondary: Primary
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.