retinol binding protein 3, interstitial, Mouse, Polyclonal Antibody, Abnova™

Description

• Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells
• It is thought to transport retinoids between the retinal pigment epithelium and the photoreceptors, a critical role in the visual process.The human IRBP gene is approximately 9.5kb in length and consists of four exons separated by three introns
• The introns are 1.6-1.9kb long
• The gene is transcribed by photoreceptor and retinoblastoma cells into an approximately 4.3-kilobase mRNA that is translated and processed into a glycosylated protein of 135,000 Da
• The amino acid sequence of human IRBP can be divided into four contiguous homology domains with 33-38% identity, suggesting a series of gene duplication events
• In the gene, the boundaries of these domains are not defined by exon-intron junctions, as might have been expected
• The first three homology domains and part of the fourth are all encoded by the first large exon, which is 3,180 base pairs long
• The remainder of the fourth domain is encoded in the last three exons, which are 191, 143, and approximately 740 base pairs long, respectively
• [provided by RefSeq Sequence: GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH