ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Mouse, Polyclonal Antibody, Abnova™

Description

• This gene encodes a multidomain protein containing an N-terminal alpha-helical region with a coiled-coil motif, followed by a pleckstrin homology (PH) domain, an Arf-GAP domain, an ankyrin homology region, a proline-rich region, and a C-terminal Src homology 3 (SH3) domain
• The protein localizes in the Golgi apparatus and at the plasma membrane, where it colocalizes with protein tyrosine kinase 2-beta (PYK2)
• The encoded protein forms a stable complex with PYK2 in vivo
• This interaction appears to be mediated by binding of its SH3 domain to the C-terminal proline-rich domain of PYK2
• The encoded protein is tyrosine phosphorylated by activated PYK2
• It has catalytic activity for class I and II ArfGAPs in vitro, and can bind the class III Arf ARF6 without immediate GAP activity
• The encoded protein is believed to function as an ARF GAP that controls ARF-mediated vesicle budding when recruited to Golgi membranes
• In addition, it functions as a substrate and downstream target for PYK2 and SRC, a pathway that may be involved in the regulation of vesicular transport
• Multiple transcript variants encoding different isoforms have been found for this gene
• [provided by RefSeq Sequence: RGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD