ERBB3, Mouse, Clone: 2A4, Abnova™

Description

• This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases
• This membrane-bound protein has a neuregulin binding domain but not an active kinase domain
• It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation
• However, it does form heterodimers with other EGF receptor family members which do have kinase activity
• Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation
• Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors
• Alternate transcriptional splice variants encoding different isoforms have been characterized
• One isoform lacks the intermembrane region and is secreted outside the cell
• This form acts to modulate the activity of the membrane-bound form
• Additional splice variants have also been reported, but they have not been thoroughly characterized
• [provided by RefSeq Sequence: EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF