CLEC4M, Mouse, Polyclonal Antibody, Abnova™

Description

• This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver
• The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health
• The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain
• The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells
• The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity
• Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability
• This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209)
• DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution
• Alternative splicing results in multiple variants Sequence: SQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAA