GCNT2 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB035113-Each-of-1 | In Stock | ₹ 41,710.50 |
NB035113 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
GCNT2
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
2651
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Alias
bA360O19.2, bA421M1.1, beta-1,6-N-acetylglucosaminyltransferase 2, cataract, congenital, CCAT, EC 2.4.1.150, GCNT2C, GCNT5, glucosaminyl (N-acetyl) transferase 2, I-branching enzyme, glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group), glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (Ii blood group), I beta-1,6-N-acetylglucosaminyltransferase, I-branching beta-1,6-acetylglucosaminyltransferase, I-branching enzyme, IGNTglucosaminyl (N-acetyl) transferase 5, II, Ii blood group, MGC163396, N-acetylglucosaminyltransferase, N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase, N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, NACGT1, NAGCT1, ULG3
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCNT2
Quantity
100 μL
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- GCNT2 Polyclonal specifically detects GCNT2 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: GCNT2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 2651
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: bA360O19.2, bA421M1.1, beta-1,6-N-acetylglucosaminyltransferase 2, cataract, congenital, CCAT, EC 2.4.1.150, GCNT2C, GCNT5, glucosaminyl (N-acetyl) transferase 2, I-branching enzyme, glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group), glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (Ii blood group), I beta-1,6-N-acetylglucosaminyltransferase, I-branching beta-1,6-acetylglucosaminyltransferase, I-branching enzyme, IGNTglucosaminyl (N-acetyl) transferase 5, II, Ii blood group, MGC163396, N-acetylglucosaminyltransferase, N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase, N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, NACGT1, NAGCT1, ULG3
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCNT2
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: GCSH
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 2653
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: GCE, glycine cleavage system H protein, mitochondrial, glycine cleavage system protein H (aminomethyl carrier), lipoic acid-containing protein, mitochondrial glycine cleavage system H-protein, NKH
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of GCSH
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: GCSH
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 2653
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: __
Gene Alias: GCE, glycine cleavage system H protein, mitochondrial, glycine cleavage system protein H (aminomethyl carrier), lipoic acid-containing protein, mitochondrial glycine cleavage system H-protein, NKH
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human
Form: Purified
