DNMT3A Antibody (64B1446), Alexa Fluor™ 647, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB12013888Y-Each-of-1 | In Stock | ₹ 58,351.92 |
NB12013888Y - Each of 1
In Stock
Quantity
1
Base Price: ₹ 58,351.92
GST (18%): ₹ 10,503.346
Total Price: ₹ 68,855.266
Antigen
DNMT3A
Classification
Monoclonal
Conjugate
Alexa Fluor 647
Formulation
50mM Sodium Borate with 0.05% Sodium Azide
Gene Alias
DNA (cytosine-5-)-methyltransferase 3 alpha, DNA (cytosine-5)-methyltransferase 3A, DNA cytosine methyltransferase 3A2, DNA methyltransferase HsaIIIA, DNA MTase HsaIIIA, Dnmt3a, DNMT3A2, EC 2.1.1.37, M.HsaIIIA
Host Species
Mouse
Purification Method
Protein G purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Cross-reacts with Human (weakly) and Mouse. Not yet tested in other species.
Content And Storage
Store at 4C in the dark.
Isotype
IgG1 κ
Applications
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone
64B1446
Dilution
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Whole-Mount
Gene Accession No.
Q9Y6K1
Gene Symbols
DNMT3A
Immunogen
This DNMT3A antibody was raised against bacteria expressed recombinant mouse Dnmt3a. The epitope was found to lie near the C-terminus (a.a. 705-908), see Chen et (2002) for details.
Quantity
0.1 mL
Research Discipline
Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics
Gene ID (Entrez)
1788
Target Species
Human, Mouse
Form
Purified
Related Products
Description
- DNMT3A Monoclonal specifically detects DNMT3A in Human, Mouse samples
- It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Whole-Mount.
Compare Similar Items
Show Difference
Antigen: DNMT3A
Classification: Monoclonal
Conjugate: Alexa Fluor 647
Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
Gene Alias: DNA (cytosine-5-)-methyltransferase 3 alpha, DNA (cytosine-5)-methyltransferase 3A, DNA cytosine methyltransferase 3A2, DNA methyltransferase HsaIIIA, DNA MTase HsaIIIA, Dnmt3a, DNMT3A2, EC 2.1.1.37, M.HsaIIIA
Host Species: Mouse
Purification Method: Protein G purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Cross-reacts with Human (weakly) and Mouse. Not yet tested in other species.
Content And Storage: Store at 4C in the dark.
Isotype: IgG1 κ
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone: 64B1446
Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Whole-Mount
Gene Accession No.: Q9Y6K1
Gene Symbols: DNMT3A
Immunogen: This DNMT3A antibody was raised against bacteria expressed recombinant mouse Dnmt3a. The epitope was found to lie near the C-terminus (a.a. 705-908), see Chen et (2002) for details.
Quantity: 0.1 mL
Research Discipline: Chromatin Modifiers, Chromatin Research, DNA Methyltransferases, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics
Gene ID (Entrez): 1788
Target Species: Human, Mouse
Form: Purified
Antigen: Spermine Binding Protein
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% sucrose
Gene Alias: __
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: __
Applications: Western Blot
Clone: __
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: P15501
Gene Symbols: __
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Spermine Binding Protein (NP_035451.1). Peptide sequence NWTDVYGTRSDNFIDFLLEDGEHVIKVEGSAVICLTSLTFTTNKGRVATF
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 20234
Target Species: Mouse
Form: Purified
Antigen: beta-2 Adrenergic R/ADRB2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS with 0.02% Sodium Azide
Gene Alias: ADRBR, adrenergic, beta-2-, receptor, surface, B2ARADRB2R, BAR, beta-2 adrenergic receptor, Beta-2 adrenoceptor, Beta-2 adrenoreceptor, BETA2AR, catecholamine receptor
Host Species: Chicken
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Cross-reacts with Human. Not yet tested in other species.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: __
Applications: Western Blot
Clone: __
Dilution: Western Blot 1:100-1:2000
Gene Accession No.: P07550
Gene Symbols: ADRB2
Immunogen: Synthetic peptide: DFRIAFQELLC LRRSSLKAYGN GYSSNGNTGE QSGYHVEQEKE NKLLCEDLPGT EDFVGHQGTVP SDNIDSQGRNCS T, corresponding to amino acids 335-408 of Human Beta 2 Adrenergic Receptor (NP_000015.1).
Quantity: 0.05 mg
Research Discipline: __
Gene ID (Entrez): 154
Target Species: Human
Form: __
