AlphaA Crystallin/CRYAA Antibody (c9F2) - BSA Free, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB120148215-Each-of-1 | In Stock | ₹ 36,448.56 |
NB120148215 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 36,448.56
GST (18%): ₹ 6,560.741
Total Price: ₹ 43,009.301
Antigen
AlphaA Crystallin/CRYAA
Classification
Monoclonal
Concentration
1.0 mg/mL
Dilution
Western Blot 1:1000-1:2000, ELISA 1:100-1:2000
Gene Accession No.
P02489
Gene Symbols
CRYAA
Immunogen
E. coli-derived recombinant protein corresponding to full-length (aa1-173) human crystallin alpha A.
Primary or Secondary
Primary
Test Specificity
NB120-14821 recognizes alpha A crystallin, a 20kDa water-soluble major structural protein and member of the heat shock protein family, designated HSPB4, which acts as a molecular chaperone and is believed to play a role in the maintenance of ocular lens transparency/refractive index. Besides the involvement of both alpha A and alpha B crystallin in the prevention of protein precipitation and cataract formation in the eye, alpha crystallins have also been demonstrated in other tissues including the heart, brain, kidney, spleen and thymus.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, ELISA
Clone
c9F2
Conjugate
Unconjugated
Formulation
PBS (pH 7.4) and 10% Glycerol with 0.09% sodium azide
Gene Alias
CRYA1crystallin, alpha-1, crystallin, alpha A, Heat shock protein beta-4, HSPB4alpha-crystallin A chain, human alphaA-crystallin (CRYA1), 10HspB4
Host Species
Mouse
Quantity
0.05 mL
Gene ID (Entrez)
1409
Target Species
Human, Rat
Isotype
IgG1 κ
Related Products
Description
- AlphaA Crystallin/CRYAA Monoclonal specifically detects AlphaA Crystallin/CRYAA in Human, Rat samples
- It is validated for Western Blot, ELISA.
Compare Similar Items
Show Difference
Antigen: AlphaA Crystallin/CRYAA
Classification: Monoclonal
Concentration: 1.0 mg/mL
Dilution: Western Blot 1:1000-1:2000, ELISA 1:100-1:2000
Gene Accession No.: P02489
Gene Symbols: CRYAA
Immunogen: E. coli-derived recombinant protein corresponding to full-length (aa1-173) human crystallin alpha A.
Primary or Secondary: Primary
Test Specificity: NB120-14821 recognizes alpha A crystallin, a 20kDa water-soluble major structural protein and member of the heat shock protein family, designated HSPB4, which acts as a molecular chaperone and is believed to play a role in the maintenance of ocular lens transparency/refractive index. Besides the involvement of both alpha A and alpha B crystallin in the prevention of protein precipitation and cataract formation in the eye, alpha crystallins have also been demonstrated in other tissues including the heart, brain, kidney, spleen and thymus.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, ELISA
Clone: c9F2
Conjugate: Unconjugated
Formulation: PBS (pH 7.4) and 10% Glycerol with 0.09% sodium azide
Gene Alias: CRYA1crystallin, alpha-1, crystallin, alpha A, Heat shock protein beta-4, HSPB4alpha-crystallin A chain, human alphaA-crystallin (CRYA1), 10HspB4
Host Species: Mouse
Quantity: 0.05 mL
Gene ID (Entrez): 1409
Target Species: Human, Rat
Isotype: IgG1 κ
Antigen: Paladin
Classification: Polyclonal
Concentration: __
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: __
Gene Symbols: __
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Paladin (NP_055246). Peptide sequence GHRVKKEVDAALDTVSETMTPMHYHLREIIICTYRQAKAAKEAQEMRRLQ
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Clone: __
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Gene Alias: KIAA1274, paladin, PALD, palladin
Host Species: Rabbit
Quantity: 100 μg
Gene ID (Entrez): 27143
Target Species: Human
Isotype: __
Antigen: Claudin-1
Classification: Polyclonal
Concentration: 0.2 mg/mL
Dilution: Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin 1:50-1:100
Gene Accession No.: __
Gene Symbols: CLDN1
Immunogen: Synthetic peptide (Human) (C terminal).
Primary or Secondary: Primary
Test Specificity: Claudin 1
Content And Storage: Store at 4C. Do not freeze.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone: __
Conjugate: Unconjugated
Formulation: PBS (pH 7.4), 0.2% BSA, Tween-20 with 0.05% Sodium Azide
Gene Alias: claudin 1, claudin-1, CLD1, ILVASCSenescence-associated epithelial membrane protein, SEMP1senescence-associated epithelial membrane protein 1
Host Species: Rabbit
Quantity: 0.5 mL
Gene ID (Entrez): 9076
Target Species: Human, Mouse, Rat, Canine, Primate
Isotype: IgG
