Twist-1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB12049254-Each-of-1 | In Stock | ₹ 42,737.22 |
NB12049254 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,737.22
GST (18%): ₹ 7,692.70
Total Price: ₹ 50,429.92
Antigen
Twist-1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols
TWIST1
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human Twist-1. Peptide Sequence DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW. The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Protein A purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
TWIST1
Target Species
Human, Rat, Porcine, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Form
Purified
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Alias
acrocephalosyndactyly 3, ACS3, B-HLH DNA binding protein, BHLHA38, bHLHa38BPES3, Class A basic helix-loop-helix protein 38, CRS1, H-twistblepharophimosis, epicanthus inversus and ptosis 3, SCSBPES2, TWIST, twist homolog 1 (Drosophila), TWIST homolog of drosophila, twist-related protein 1
Host Species
Rabbit
Molecular Weight of Antigen
21 kDa
Quantity
100 μL
Research Discipline
Cancer
Gene ID (Entrez)
7291
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Related Products
Description
- Twist-1 Polyclonal specifically detects Twist-1 in Human, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Twist-1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: TWIST1
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Twist-1. Peptide Sequence DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW. The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: TWIST1
Target Species: Human, Rat, Porcine, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Form: Purified
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Gene Alias: acrocephalosyndactyly 3, ACS3, B-HLH DNA binding protein, BHLHA38, bHLHa38BPES3, Class A basic helix-loop-helix protein 38, CRS1, H-twistblepharophimosis, epicanthus inversus and ptosis 3, SCSBPES2, TWIST, twist homolog 1 (Drosophila), TWIST homolog of drosophila, twist-related protein 1
Host Species: Rabbit
Molecular Weight of Antigen: 21 kDa
Quantity: 100 μL
Research Discipline: Cancer
Gene ID (Entrez): 7291
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Antigen: ATG5
Classification: Monoclonal
Conjugate: Alexa Fluor 488
Formulation: 50mM Sodium Borate
Gene Symbols: __
Immunogen: E. coli-derived recombinant human ATG5, Asn99-Thr193, Accession # Q9H1Y0
Purification Method: Protein A or G purified from hybridoma culture supernatant
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat
Form: Purified
Applications: Western Blot, Immunohistochemistry
Concentration: __
Dilution: Western Blot, Immunohistochemistry
Gene Alias: APG5, APG5 (Autophagy 5, S. Cerevisiae)-Like, APG5 autophagy 5-like (S. cerevisiae), APG5L, APG5-LIKE, ASP, ASPAPG5-LIKE, ATG5 Autophagy Related 5 Homolog, ATG5 autophagy related 5 homolog (S. cerevisiae), Autophagy protein 5, Autophagy Related 5, HAPG5, SCAR25
Host Species: Mouse
Molecular Weight of Antigen: __
Quantity: 0.1 mL
Research Discipline: Apoptosis, Autophagy, Cancer, Cardiovascular Biology, Cell Biology, Ubiquitin Proteasome Pathway
Gene ID (Entrez): 9474
Reconstitution: __
Content And Storage: Store at 4°C in the dark.
Isotype: IgG2b
Antigen: ATG5
Classification: Monoclonal
Conjugate: HRP
Formulation: PBS
Gene Symbols: __
Immunogen: E. coli-derived recombinant human ATG5, Asn99-Thr193, Accession # Q9H1Y0
Purification Method: Protein A or G purified from hybridoma culture supernatant
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human, Mouse, Rat
Form: Purified
Applications: Western Blot, Immunohistochemistry
Concentration: __
Dilution: Western Blot, Simple Western, Immunohistochemistry
Gene Alias: APG5, APG5 (Autophagy 5, S. Cerevisiae)-Like, APG5 autophagy 5-like (S. cerevisiae), APG5L, APG5-LIKE, ASP, ASPAPG5-LIKE, ATG5 Autophagy Related 5 Homolog, ATG5 autophagy related 5 homolog (S. cerevisiae), Autophagy protein 5, Autophagy Related 5, HAPG5, SCAR25
Host Species: Mouse
Molecular Weight of Antigen: __
Quantity: 0.1 mL
Research Discipline: Apoptosis, Autophagy, Cancer, Cardiovascular Biology, Cell Biology, Ubiquitin Proteasome Pathway
Gene ID (Entrez): 9474
Reconstitution: __
Content And Storage: Store at 4°C in the dark.
Isotype: IgG2b