c-Myc Antibody (SPM237), FITC, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB123264-Each-of-1 | In Stock | ₹ 56,298.48 |
NB123264 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 56,298.48
GST (18%): ₹ 10,133.726
Total Price: ₹ 66,432.206
Antigen
c-Myc
Classification
Monoclonal
Conjugate
FITC
Formulation
PBS
Host Species
Mouse
Purification Method
Protein A or G purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human, Chicken (Negative), Mouse (Negative), Rat (Negative)
Form
Purified
Applications
Flow Cytometry, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunofluorescence
Clone
SPM237
Dilution
Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunofluorescence
Gene Alias
avian myelocytomatosis viral oncogene homolog, BHLHE39, bHLHe39MRTL, Class E basic helix-loop-helix protein 39, c-Myc, MYC, myc proto-oncogene protein, MYCC, myc-related translation/localization regulatory factor, Proto-oncogene c-Myc, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog, v-myc myelocytomatosis viral oncogene homolog (avian)
Immunogen
A synthetic peptide, corresponding to aa 408-439 (AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA) from C-terminus of human c-Myc, coupled to KLH.
Quantity
0.1 mL
Research Discipline
Autophagy, Cancer, Cancer Stem Cells, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Epigenetics, Epitope Tags, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
Gene ID (Entrez)
4609
Content And Storage
Store at 4°C in the dark.
Isotype
IgG1 κ
Related Products
Description
- c-Myc Monoclonal antibody specifically detects c-Myc in Human samples
- It is validated for Flow Cytometry, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunofluorescence
Compare Similar Items
Show Difference
Antigen: c-Myc
Classification: Monoclonal
Conjugate: FITC
Formulation: PBS
Host Species: Mouse
Purification Method: Protein A or G purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Chicken (Negative), Mouse (Negative), Rat (Negative)
Form: Purified
Applications: Flow Cytometry, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunofluorescence
Clone: SPM237
Dilution: Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunofluorescence
Gene Alias: avian myelocytomatosis viral oncogene homolog, BHLHE39, bHLHe39MRTL, Class E basic helix-loop-helix protein 39, c-Myc, MYC, myc proto-oncogene protein, MYCC, myc-related translation/localization regulatory factor, Proto-oncogene c-Myc, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog, v-myc myelocytomatosis viral oncogene homolog (avian)
Immunogen: A synthetic peptide, corresponding to aa 408-439 (AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA) from C-terminus of human c-Myc, coupled to KLH.
Quantity: 0.1 mL
Research Discipline: Autophagy, Cancer, Cancer Stem Cells, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Epigenetics, Epitope Tags, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
Gene ID (Entrez): 4609
Content And Storage: Store at 4°C in the dark.
Isotype: IgG1 κ
Antigen: beta-Actin
Classification: Polyclonal
Conjugate: Janelia Fluor 646
Formulation: 50mM Sodium Borate
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat, Amphibian
Form: Purified
Applications: ELISA, Immunohistochemistry, Immunofluorescence
Clone: __
Dilution: ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Gene Alias: ACTB, actin, beta, actin, cytoplasmic 1, B-Actin, Beta Actin, beta cytoskeletal actin, Beta-actin, BRWS1, I(2)-Actin, PS1TP5-binding protein 1, PS1TP5BP1
Immunogen: beta-Actin Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to C-Terminal region near amino acids 350-375 of Human beta Actin. (Uniprot: P60709)
Quantity: 0.1 mL
Research Discipline: Angiogenesis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Loading Controls, Signal Transduction, Stem Cell Markers
Gene ID (Entrez): 60
Content And Storage: Store at 4°C in the dark.
Isotype: IgG
Antigen: nkx6.2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Clone: __
Dilution: Western Blot 1.0 ug/ml
Gene Alias: GTXhomeobox 6B, Homeobox protein NK-6 homolog B, homeobox protein Nkx-6.2, MGC126684, NK homeobox family 6, B, NK6 homeobox 2, NK6 transcription factor related, locus 2, NK6 transcription factor related, locus 2 (Drosophila), NKX6.1, NKX6.2, NKX6Bglial and testis-specific homeobox protein
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human nkx6.2 (NP_796374). Peptide sequence PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 84504
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: __
