POLR2J3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB124273-Each-of-1 | In Stock | ₹ 41,710.50 |
NB124273 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
POLR2J3
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
DNA-Directed RNA Polymerase II Subunit 11, DNA-Directed RNA Polymerase II Subunit J3, DNA-Directed RNA Polymerase II Subunit RPB11-B2, Polymerase (RNA) II (DNA Directed) Polypeptide J3, Polymerase (RNA) II Subunit J3, RNA Polymerase II Subunit B11-B2, RNA Polymerase II Subunit J3, RPB11b1, RPB11b2
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human POLR2J2 (NP_001091084). Peptide sequence APPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKD
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
548644
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- POLR2J3 Polyclonal specifically detects POLR2J3 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: POLR2J3
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: DNA-Directed RNA Polymerase II Subunit 11, DNA-Directed RNA Polymerase II Subunit J3, DNA-Directed RNA Polymerase II Subunit RPB11-B2, Polymerase (RNA) II (DNA Directed) Polypeptide J3, Polymerase (RNA) II Subunit J3, RNA Polymerase II Subunit B11-B2, RNA Polymerase II Subunit J3, RPB11b1, RPB11b2
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human POLR2J2 (NP_001091084). Peptide sequence APPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKD
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 548644
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: ALG1L2
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: __
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1L2 (NP_001129624.1). Peptide sequence FKEAPLDLQHRLFMKLGSTHSPFRARSEPEDPDTERSAFTERDSGSGLVT
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 644974
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: SLC35G4
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: __
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC35G4 (XP_934053). Peptide sequence SHPYFNLPDSTHPSPPSTPPSLHWHQRCQPSDATNGLLVALLGGGLPAGF
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 646000
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
