JWA Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB124893-Each-of-1 | In Stock | ₹ 41,710.50 |
NB124893 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
JWA
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, Aip-5, ARL-6-interacting protein 5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, DERP11addicsin, Glutamate transporter EAAC1-interacting protein, glutamate transporter EEAC1-associated protein, GTRAP3-18aip-5, hp22, HSPC127, JM5, jmx, JWAcytoskeleton related vitamin A responsive protein, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF3dermal papilla derived protein 11, Prenylated Rab acceptor protein 2, Protein JWa, putative MAPK activating protein PM27, Putative MAPK-activating protein PM27
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human JWA (NP_075368.1). Peptide sequence MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Mouse
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
10550
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- JWA Polyclonal specifically detects JWA in Mouse samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: JWA
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, Aip-5, ARL-6-interacting protein 5, Cytoskeleton-related vitamin A-responsive protein, Dermal papilla-derived protein 11, DERP11addicsin, Glutamate transporter EAAC1-interacting protein, glutamate transporter EEAC1-associated protein, GTRAP3-18aip-5, hp22, HSPC127, JM5, jmx, JWAcytoskeleton related vitamin A responsive protein, PRA1 domain family 3, PRA1 family protein 3, PRA2, PRAF3dermal papilla derived protein 11, Prenylated Rab acceptor protein 2, Protein JWa, putative MAPK activating protein PM27, Putative MAPK-activating protein PM27
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human JWA (NP_075368.1). Peptide sequence MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 10550
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: RRAGA
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: Adenovirus E3 14.7 kDa-interacting protein 1, FIP1, FIP-1adenovirus E3-14.7K interacting protein 1, Rag A, RagA, RAGAras-related GTP-binding protein A, Ras-related GTP binding A
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RRAGA (NP_006561.1). Peptide sequence HSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVES
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 10670
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: TMED1
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml, Aggregation
Gene Alias: Il1rl1l, IL1RL1LGIL1RL1-binding protein, interleukin 1 receptor-like 1 ligand, Interleukin-1 receptor-like 1 ligand, MGC1270, Putative T1/ST2 receptor-binding protein, ST2L, T1/ST2 receptor binding protein, transmembrane emp24 domain containing 1, transmembrane emp24 domain-containing protein 1, transmembrane emp24 protein transport domain containing 1
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMED1 (NP_034874.2). Peptide sequence MEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLERVNFWSAAN
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse
Form: Purified
Applications: Western Blot, Aggregation
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 11018
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
