HDHD1A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB124949-Each-of-1 | In Stock | ₹ 41,710.50 |
NB124949 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
HDHD1A
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
DXF68S1E5'-PsiMPase, EC 3.1.3.n6, family with sequence similarity 16, member A, X-linked, GS1FAM16AX, haloacid dehalogenase-like hydrolase domain containing 1, haloacid dehalogenase-like hydrolase domain containing 1A, Haloacid dehalogenase-like hydrolase domain-containing protein 1, Haloacid dehalogenase-like hydrolase domain-containing protein 1A, HDHD1Apseudouridine-5'-monophosphatase, Protein GS1
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HDHD1 (NP_001129037.1). Peptide sequence THLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAA
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
8226
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- HDHD1A Polyclonal specifically detects HDHD1A in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: HDHD1A
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: DXF68S1E5'-PsiMPase, EC 3.1.3.n6, family with sequence similarity 16, member A, X-linked, GS1FAM16AX, haloacid dehalogenase-like hydrolase domain containing 1, haloacid dehalogenase-like hydrolase domain containing 1A, Haloacid dehalogenase-like hydrolase domain-containing protein 1, Haloacid dehalogenase-like hydrolase domain-containing protein 1A, HDHD1Apseudouridine-5'-monophosphatase, Protein GS1
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HDHD1 (NP_001129037.1). Peptide sequence THLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAA
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 8226
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: NYX
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: __
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NYX (NP_072089.1). Peptide sequence GSGRVTDVPCASPGSVAGLDLSQVTFGRSSDGLCVDPEELNLTTSSPGPS
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 60506
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: Melanocortin-3 R/MC3R
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: BMIQ9, MC3, MC3-R, melanocortin 3 receptor, melanocortin receptor 3, OB20, Obesity quantitative trait locus, OQTL
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Melanocortin-3 R/MC3R (NP_063941.3). Peptide sequence PTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCN
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 4159
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
