TCF7L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB125495-Each-of-1 | In Stock | ₹ 41,710.50 |
NB125495 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
TCF7L2
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
HMG box transcription factor 4, hTCF-4, T-cell factor 4, T-cell factor-4 variant A, T-cell factor-4 variant B, T-cell factor-4 variant C, T-cell factor-4 variant D, T-cell factor-4 variant E, T-cell factor-4 variant H, T-cell factor-4 variant I, T-cell factor-4 variant J, T-cell factor-4 variant K, T-cell factor-4 variant L, T-cell factor-4 variant M, T-cell factor-4 variant X2, T-cell-specific transcription factor 4, TCF-4T-cell factor-4 variant F, TCF4T-cell factor-4 variant G, transcription factor 7-like 2, transcription factor 7-like 2 (T-cell specific, HMG-box)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TCF7L2 (NP_110383). Peptide sequence GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES
Quantity
100 μg
Research Discipline
Cancer, Signal Transduction, Wnt Signaling Pathway
Gene ID (Entrez)
6934
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Related Products
Description
- TCF7L2 Polyclonal specifically detects TCF7L2 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: TCF7L2
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: HMG box transcription factor 4, hTCF-4, T-cell factor 4, T-cell factor-4 variant A, T-cell factor-4 variant B, T-cell factor-4 variant C, T-cell factor-4 variant D, T-cell factor-4 variant E, T-cell factor-4 variant H, T-cell factor-4 variant I, T-cell factor-4 variant J, T-cell factor-4 variant K, T-cell factor-4 variant L, T-cell factor-4 variant M, T-cell factor-4 variant X2, T-cell-specific transcription factor 4, TCF-4T-cell factor-4 variant F, TCF4T-cell factor-4 variant G, transcription factor 7-like 2, transcription factor 7-like 2 (T-cell specific, HMG-box)
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCF7L2 (NP_110383). Peptide sequence GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES
Quantity: 100 μg
Research Discipline: Cancer, Signal Transduction, Wnt Signaling Pathway
Gene ID (Entrez): 6934
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: Claudin-11
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Alias: claudin 11, claudin-11, Oligodendrocyte-specific protein, OSPOTMoligodendrocyte transmembrane protein
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Claudin-11 (NP_005593). Peptide sequence VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Quantity: 100 μg
Research Discipline: __
Gene ID (Entrez): 5010
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Antigen: Claudin-11
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Alias: claudin 11, claudin-11, Oligodendrocyte-specific protein, OSPOTMoligodendrocyte transmembrane protein
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Claudin-11 (NP_005593). Peptide sequence VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Quantity: 25 μg
Research Discipline: __
Gene ID (Entrez): 5010
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Target Species: Human
Form: Purified
